Identifiers and Description

Gene Model Identifier

TTHERM_00658750

Standard Name

RRM41 (RNA recognition motif-containing protein 41)

Aliases

PreTt02160 | 97.m00146 | 3724.m00053

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00098 ) Zinc knuckle
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00658750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16217.15.9995201161793426e-102RNA binding protein (316 aa)
OxytrichaContig1956.0.g140.00000019998969434520019RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000039020.0000029996948234116693locus:pab-1 status:Confirmed
UniProt:Q9U302 protein_id
:CAA21572.1
DictyBaseDDB_G02836870.000004000864880866421DDB_G0283687 on chromosome: 4
position 982205 to 984735
SGDYER165W0.000004000864880866421PAB1 Poly(A) binding protein,
part of the 3-end RNA-processi
ng complex, mediates interacti
ons between the 5 cap structur
e and the 3 mRNA poly(A) tail,
involved in control of poly(A
) tail length, interacts with
translation factor eIF-4G

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00658750(coding)
ATGTCATTCTCTATTAAAAGTAATTAGATTGATAAATAGATAGATAGACAGAAAAGCAGA
TCAAACAAAGTGATATATATTTATAAAACTATTAATCAAAGAAAGGAAAGTCATAAAAAA
AATAATAATAAATTAGAAGAAATAAATAAATAAATTTTGAAAAAATAATAATTGCATTAA
ATTTAAAAAATGTCTCGCCCATAAACAAAGCTTTATGTTGCCAAATTCGGTAACAACGTA
GGTAGAAAAGAAATCGAAGAAACTTTTGGTAAGTATGGTGATATCTATAGTTGCAAAGTA
AATGACCGTGAAGGTTATGCAACTGTATCTTACAAATATTAAGATTAAGCTGATAAAGCT
ATTTCAAAACTTAATGGATCTGATGTTTTAGGTGGAAGTTTATTGGTAGAACATACTCTC
AAGAAGAGCAGAGATGATGACCATAGCAGATATCCCAGAGACAGCAGATATGGTAACAGC
AGTTATAGAGATCAAAATGGATACAGAGGAGGTCCTTAAAGCTCTTCTCGTTATGGTGGA
GATCGTGGTCGCAGTAGTGGAGATAGAGATAGCTACAGAAGAGGAACTAGTGGACCACCT
AGAACTGATAAAGAAAAATATATGAAGGAAGGTTTATGCTTCACCTGCAAGGGATAAGGT
CATATCTCTAAAAATTGTCCTGAAGCTAGAAACGGTGGAAGTGGAAGAGACAGAAGAGAC
TCTAGAGGCGGAAGAGTTAATGGATTTAGACCTGATAGAGAAAGAAGACCTTATAGAGAA
AGAAGTAGAAGTAATGATAGAAGCAAGGGCAAGAGCAGAAGAGACAATAGCAGAAGCAGA
AGCCCTCATGATAAGTATGCTGACAAGGATAGAAAGAGAAGATCAAGAAAGCACTCTAGA
AAGAGCAGTTCTTCTAGCAGCCACTCAGGAAGATCTAATTCTAGAAAGGACAGAAAGAGA
TCTGAATCTTCCTCTTCTCAATCCTCTAGATCAAATTCTAATTCTAGCCGCTCTAATTCA
GCAAGCGTTAATAAGTAATAAAATGGAGATATGAAAATGAACGGCAACATGAATGACTAA
ATTAAAGATATGAATGTTTCTCAATGA


>TTHERM_00658750(protein)
MSFSIKSNQIDKQIDRQKSRSNKVIYIYKTINQRKESHKKNNNKLEEINKQILKKQQLHQ
IQKMSRPQTKLYVAKFGNNVGRKEIEETFGKYGDIYSCKVNDREGYATVSYKYQDQADKA
ISKLNGSDVLGGSLLVEHTLKKSRDDDHSRYPRDSRYGNSSYRDQNGYRGGPQSSSRYGG
DRGRSSGDRDSYRRGTSGPPRTDKEKYMKEGLCFTCKGQGHISKNCPEARNGGSGRDRRD
SRGGRVNGFRPDRERRPYRERSRSNDRSKGKSRRDNSRSRSPHDKYADKDRKRRSRKHSR
KSSSSSSHSGRSNSRKDRKRSESSSSQSSRSNSNSSRSNSASVNKQQNGDMKMNGNMNDQ
IKDMNVSQ


>TTHERM_00658750(gene)
TGATTTTGACTAAAAAATTCAGATTTCTTTTTATTTATTTAATAAATTTAAAAAGAGAGA
AACAGATGTCATTCTCTATTAAAAGTAATTAGATTGATAAATAGATAGATAGACAGAAAA
GCAGATCAAACAAAGTGATATATATTTATAAAACTATTAATCAAAGAAAGGAAAGTCATA
AAAAAAATAATAATAAATTAGAAGAAATAAATAAATAAATTTTGAAAAAATAATAATTGC
ATTAAATTTAAAAAATGTCTCGCCCATAAACAAAGCTTTATGTTGCCAAATTCGGTAACA
ACGTAGGTAGAAAAGAAATCGAAGAAACTTTTGGTAAGTATGGTGATATCTATAGTTGCA
AAGTAAATGACCGTGAAGGTTATGCAACTGTATCTTACAAATATTAAGATTAAGCTGATA
AAGCTATTTCAAAACTTAATGGATCTGATGTTTTAGGTGGAAGTTTATTGGTAGAACATA
CTCTCAAGAAGAGCAGAGATGATGACCATAGCAGATATCCCAGAGACAGCAGATATGGTA
ACAGCAGTTATAGAGATCAAAATGGATACAGAGGAGGTCCTTAAAGCTCTTCTCGTTATG
GTGGAGATCGTGGTCGCAGTAGTGGAGATAGAGATAGCTACAGAAGAGGAACTAGTGGAC
CACCTAGAACTGATAAAGAAAAATATATGAAGGAAGGTTTATGCTTCACCTGCAAGGGAT
AAGGTCATATCTCTAAAAATTGTCCTGAAGCTAGAAACGGTGGAAGTGGAAGAGACAGAA
GAGACTCTAGAGGCGGAAGAGTTAATGGTAAATATTTGATATAATCAATCATATATGTTT
AATAAATAAAATCCTCTTAACTCCTTTAGAATATTTAGTTTTATTTGATAAAAAAATGAA
TAAATATAATTTTAAAATGAATTATTTAACATTTTCGAATGCTAAATATTTAAGGAATCA
TAGATTTTGAAAATTTATTTGGTTTATTGGTCTTGCGTTTAAACAAATCTCATTAAAATT
TAAAAATGAGTTTTTTTGTTTTTTAAATTCTTAACTCCTTAGGACTGAAATTGATTGATT
AATTTATTTAATTTTCTGCTTTTCTTCTATTATATTAGCTTAATTTGTTGTGAAAAAGGA
CAATAGATAGATAATTAGATAGTTAGCTAAAAATTCTTTTTAAATTAATCTCAAACTTCC
TTTTATATTAAATAATCTAATTAATTAATTAATATTCACTGATGTGTCTAATTAGTTAAT
TAATTTCAGAGAAATAAAGCACCACCAAAATACAACTTAAGCCACTTTTTTTTATTTTTT
GAATATTGCTCCAAAAGCATAAAAATTTAAATTAGAATATAATCACACATACATACATAG
TCATTTACTTATATTTAGAAACAATTTTATATAAATAATAGGATTTAGACCTGATAGAGA
AAGAAGACCTTATAGAGAAAGAAGTAGAAGTAATGATAGAAGCAAGGGCAAGAGCAGAAG
AGACAATAGCAGAAGCAGAAGCCCTCATGATAAGTATGCTGACAAGGATAGAAAGAGAAG
ATCAAGAAAGCACTCTAGAAAGAGCAGTTCTTCTAGCAGCCACTCAGGAAGATCTAATTC
TAGAAAGGACAGAAAGAGATCTGAATCTTCCTCTTCTCAATCCTCTAGATCAAATTCTAA
TTCTAGCCGCTCTAATTCAGCAAGCGTTAATAAGTAATAAAATGGAGATATGAAAATGAA
CGGCAACATGAATGACTAAATTAAAGATATGAATGTTTCTCAATGAAGATCATTTAATCA
AAATAAAACAATATAAATAAATAATTGATTCTTTCATCTCATAAATAAGATATAATATCA
TAATATAATTAAAACTATATACTTTGAAGAGTCTTGGTGTTTTTAGTAATTTCATTCATA
ATAAATATACCTCGAGTGCTCATATAGTACCTTTAAGCCTATTATATATCTATCTATCCT
TCATTATTAGTTATGGAACAGATATTACAAGTAGATTTGAAGAGAGTAAGAATATAAGCA
AAGCTATAAACAGATAAAGCCAATAAACTAGTAAGCAGTAAAAGAAAGCAATAAATTAAG
TGAGATGCATATACATTAAGGCAGAAAAAATAATAACGAATAAAATGCTTAAGTTTATCA
ACCATAAATTGTAGTTCAAACAAACAAACAAAAAAATGTAATCAAACGAAAAAATAAAAA
AATAAGGTTTTAATTCTTCTCTTTTTAAACAAACCTCAAACTCTCTTTCTAAATACTTTA
ATCATCTAAATTCTATTATCACCATTATTATCATTATTATTATAATATATTTATATTTTT
TTTTTGAGAAAGTATAAAATAATTTTATTGTGATGTTTTTTGTTCCTTATTATTATGTGA
GACTCGATCTATGCATGAATGAATTACTATTATTTTGATTGAAATTCAGAATTGTGTTCA
GATTAGAGTTTGTTCCAGCTGAAATATGAGATTGATTGATTGAAATTATGAATGAAATGA
TTTGAAATTGAATTCAAAATGAAAAAATGATTGATTGTGTTGTTGATAAGTTTTTTGTGA
CAGATTTCAGAATTATTGTGAATTTTGTGGAAAATTAAGGAATTTATTAGATTTTTTCAA
AGAAAAGATAATTTTCATGCATGTTGGTTGGTTGGTTGAAAAAGAATGATTTGTAATTGA
AGAAATAATTTGATTAGATTTGTAAAGAAAAATTACATTGGAGAAATAAAAGAGAAAATC
AGATTTTACAGAAAAAATTAAATTTATCCAGAAAAAATATTATTTTAAAGAGAGATTTGT
TCATATTAATTATTCAATCAAGCAAGTCTAAAATTTACAAATATGAAATGAAAGAAAGAA
AGAAAGAAATAAAGAAATAAAGTAAGTTTTAAAAAAATATTACTCTAACCAAATATTTTA
GGTATGAAATCAAATAAATTTTATTCATAAAAGGCATATTATTAAATTGTATTTATTTTT
ATAATTTAGGACAAATTTTGTTGGGAGATTATCCTTTTTAAATTTATTTTATTTAAAATA
ATTTAAATCTTTTCCAAAAA