Identifiers and Description

Gene Model Identifier

TTHERM_00657460

Standard Name

RRM40 (RNA recognition motif-containing protein 40)

Aliases

PreTt02130 | 97.m00116 | 3724.m00024

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05764 ) YL1 nuclear protein
  • ( PF08512 ) Histone chaperone Rttp106-like
  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00657460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16245.19.997093137033517e-262RNA binding domain-containing
protein (695 aa)
OxytrichaContig14672.0.g471.9991939848149086e-44RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000110432.9990874792167046e-33locus:rbm-28 status:Partiall
y_confirmed UniProt:O62325
protein_id:CAB05579.2
Stentor CoeruleusSteCoe_163847.095474162284704e-23
DictyBaseDDB_G02701561.9994498063102785e-22DDB_G0270156 on chromosome: 1
position 4329080 to 4331994
SGDYPL043W1.000116773704384e-19NOP4 Nucleolar protein, essent
ial for processing and maturat
ion of 27S pre-rRNA and large
ribosomal subunit biogenesis;
constituent of 66S pre-ribosom
al particles; contains four RN
A recognition motifs (RRMs)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00657460(coding)
ATGACTGACAAAAGTAAGAAAGTAGTTGAAAAACAAGAACAAGAAAACGATTAAGATAAG
AATTAAGCCCAATAAAAGAAGGGTAGAGTTATTATTAGAAATTTAATATTTGATATCAGT
GAGAAGCATCTTAAAGGTTTGTTGGGTAAGTATGGTGAAATTATTGAAATTAATATTCCA
GTCAACCCTTCAACAAACAAATCTAAGGGTTTTGCCTTTGTCTAATTTGCTAATAAAAAC
TGTGCATTGAAAGCTATAAATGAGTTAAATGGTACTTAATGGAAGGGTAGAAATATCGTT
TTAGATTTAGCTGTTTCCAAAGAAGAATTCAAAAACCATCAATAGCCATAAAATTAACAA
GATAAATAGTAATCTAAACAAAAAGCTAAAAAATCTGAATAAATTGAAGAGGAAGAAGGA
GATGACGATGAAAAAAAAATGGATGAAGAAGAAGAAAGTGAAGATGATGAAGATCAAGAA
GACGATGATGAAGAGGATGAAGACGAAGATGATGATGAAGAAGAGGAAGACGAAGATGAT
GATAAAAATAATTAAAATAAAAAGGGAAAGAATTAATAAGGATAAAAGAAATTATTTGAA
AATGAAGATTTATCCAAAACATGTTTTGTTAGAAATTTATCTTATGATTCTACTGATAAG
GATTTAAGAACCTTCTGCCAAAACTTTGGTAAAGTAGAAATGGCAAAGGTATGTATGAAT
CATGAAACAGGAAGCAACAAAGGTACTGGTTTTGTAAAATTCTAAGATGCATAAGTAGCT
CTTAAACTTATTGCAAAGAGTAATGAACTCAGTGAAAACTGTCTTTAACAAAAAAATAAA
AAAAATGCCAGCAACATTCATGATATATTTTCAGGAATAAGCGAACTTGATCTTGAAATG
AATGGAAGAAGAATAATTTTCTTGGAAGCTAAGAAAAGAGAAGAAGTTTCTAAAGTTATG
GAAGAGAAGCTTGAAAGAAATTCAATCACTTTAGATAAAGTTAAAACTTTAGATTAATTA
GAAAAGTTTGACAGATAAGGAAAGAGAAACGTTCATTTAGCCAAGCTAGGTATTTTCGAA
GAAGAAAAAAGCATGACTAATGAAGAAAAGGAAAAGAGACGTATTCACTTATAAGAAAAA
TTGAATAAGCTAAAAAACCCTAACAACTATGTATCCTCAACAAGAATTGCCCTTATGAAC
ATACCAAAAGACGAATTCTAAGAAGAAGATATTAGACTTTATGCTCAAGCAGCACTTATA
AAAGAACATGGTCAAGAATATTTTAAAAAATAAAATCCAATTAAATAGGTCTTATTGCTT
AGAGATAAGAATAAACTTGATAAGGATGGAGTACCTAAAAGCAGAGGTATTGGATTCATA
GAATTTAATACACATGAATAAGCACTTTCATTCTTGGAATATTGTGTAAATGATAAGCAA
AACTTTGAAAAGAAATACAAGAAAACACCTATTATTGAGTTTTCAATTGAAGATGCTAGA
AAAATGGCAAAAAAGAATAAATTATTAGAAAAAGTTAAATAAAAATAAGCAGAAAAGAAG
AAAGAAAAGAAAGAATTAACTGAAGAGGAATTAGAATCAAAGAAAAAAATTCTTAAAAAT
ACGAACGAAGCAGCAAAAATAAAGATTTAAAATATTCTTGATTAATCTAACTGCAGTGAC
ATGTCTCTTTATGAGGAAGGCAAGAAATTGTTGAAGGACATAAAGAGTAGAGGTATTAAA
TAAAGAATGGCCAAGCTACTAAGAAAGAAGTTCAATATTCAAAATGAAGATAATCAAAAG
TCTAATAAATTAGTAGAAGCTATTTCCAAACAAGAGGAAAAGATCAAAAATAAGAATTCT
AAGGAAGAAAAGAGAAAGCAATTATTGAAGTAGAAAGTATAAGAAGAAAAGAAGTAGAAA
GTAGCTGAATAAAAGAAGAAGCAAAAGGAAATCGATGATGAGCTTGATGTTGATGCATCT
GAACTTATTAAGGCTGTCTCTAAAGAATTAAAGAAAAATAAAATAAGAAGATAAAACTTG
GAAGACTACGATGAATTAGATGATGTAGTTGAAAAGCATATGTAAAAGAAAGTTAAAAAA
ATAAAGCAAGAAAGTAGTGCATTGTGA


>TTHERM_00657460(protein)
MTDKSKKVVEKQEQENDQDKNQAQQKKGRVIIRNLIFDISEKHLKGLLGKYGEIIEINIP
VNPSTNKSKGFAFVQFANKNCALKAINELNGTQWKGRNIVLDLAVSKEEFKNHQQPQNQQ
DKQQSKQKAKKSEQIEEEEGDDDEKKMDEEEESEDDEDQEDDDEEDEDEDDDEEEEDEDD
DKNNQNKKGKNQQGQKKLFENEDLSKTCFVRNLSYDSTDKDLRTFCQNFGKVEMAKVCMN
HETGSNKGTGFVKFQDAQVALKLIAKSNELSENCLQQKNKKNASNIHDIFSGISELDLEM
NGRRIIFLEAKKREEVSKVMEEKLERNSITLDKVKTLDQLEKFDRQGKRNVHLAKLGIFE
EEKSMTNEEKEKRRIHLQEKLNKLKNPNNYVSSTRIALMNIPKDEFQEEDIRLYAQAALI
KEHGQEYFKKQNPIKQVLLLRDKNKLDKDGVPKSRGIGFIEFNTHEQALSFLEYCVNDKQ
NFEKKYKKTPIIEFSIEDARKMAKKNKLLEKVKQKQAEKKKEKKELTEEELESKKKILKN
TNEAAKIKIQNILDQSNCSDMSLYEEGKKLLKDIKSRGIKQRMAKLLRKKFNIQNEDNQK
SNKLVEAISKQEEKIKNKNSKEEKRKQLLKQKVQEEKKQKVAEQKKKQKEIDDELDVDAS
ELIKAVSKELKKNKIRRQNLEDYDELDDVVEKHMQKKVKKIKQESSAL


>TTHERM_00657460(gene)
ATGACTGACAAAAGTAAGAAAGTAGTTGAAAAACAAGAACAAGAAAACGATTAAGATAAG
AATTAAGCCCGTATAAAATTATTTTACTTACTAGTAGATATATGACTTAATATTATTATT
TTATAAATCAGAATAAAAGAAGGGTAGAGTTATTATTAGAAATTTAATATTTGATATCAG
TGAGAAGCATCTTAAAGGTTTGTTGGGTAAGTATGGTGAAATTATTGAAATTAATATTCC
AGTCAACCCTTCAACAAACAAATCTAAGGGTTTTGCCTTTGTCTAATTTGCTAATAAAAA
CTGTGCATTGAAAGCTATAAATGTATTTATTTGACTTTAGCTTATAAAGTAGAATTTAGA
TTATTGATTAATCAATTTTAAATTAATTAAAAGGAGTTAAATGGTACTTAATGGAAGGGT
AGAAATATCGTTTTAGATTTAGCTGTTTCCAAAGAAGAATTCAAAAACCATCAATAGCCA
TAAAATTAACAAGATAAATAGTAATCTAAACAAAAAGCTAAAAAATCTGAATAAATTGAA
GAGGAAGAAGGAGATGACGATGAAAAAAAAATGGATGAAGAAGAAGAAAGTGAAGATGAT
GAAGATCAAGAAGACGATGATGAAGAGGATGAAGACGAAGATGATGATGAAGAAGAGGAA
GACGAAGATGATGATAAAAATAATTAAAATAAAAAGGGAAAGAATTAATAAGGATAAAAG
AAATTATTTGAAAATGAAGATTTATCCAAAACATGTTTTGTTAGAAATTTATCTTATGAT
TCTACTGATAAGGATTTAAGAACCTTCTGCCAAAACTTTGGTAAAGTAGAAATGGCAAAG
GTAACTAAATAAAGTATTATGTTGGTTCTAAAGTTTAATTTAATAAAATGATATTAGGTA
TGTATGAATCATGAAACAGGAAGCAACAAAGGTACTGGTTTTGTAAAATTCTAAGATGCA
TAAGTAGCTCTTAAACTTATTGCAAAGAGTAATGAACTCAGTGAAAACTGTCTTTAACAA
AAAAATAAAAAAAATGCCAGCAACATTCATGATATATTTTCAGGTATGTGCTATTTATTA
TTTTAATATTGTTTATTTATTTAAAAATTTAAATATTCATTTTGTTAATAGGAATAAGCG
AACTTGATCTTGAAATGAATGGAAGAAGAATAATTTTCTTGGAAGCTAAGAAAAGAGAAG
AAGTTTCTAAAGTTATGGAAGAGAAGCTTGAAAGAAATTCAATCACTTTAGATAAAGTTA
AAACTTTAGATTAATTAGAAAAGTTTGACAGATAAGGAAAGAGAAACGTTCATTTAGCCA
AGCTAGGTATTTTCGAAGAAGAAAAAAGCATGACTAATGAAGAAAAGGAAAAGAGACGTA
TTCACTTATAAGAAAAATTGAATAAGCTAAAAAACCCTAACAACTATGTATCCTCAACAA
GTATACTAACATTTATATTTTTATCACTTTGATATTAAAAATATTTTTAATTTCCAAAGG
AATTGCCCTTATGAACATACCAAAAGACGAATTCTAAGAAGAAGATATTAGACTTTATGC
TCAAGCAGCACTTATAAAAGAACATGGTCAAGAATATTTTAAAAAATAAAATCCAATTAA
ATAGGTAACAACAATAATTGCTTTTTAATTTTTGATTTAAAATTTTTTTAATTATATATA
TTAAGGTCTTATTGCTTAGAGATAAGAATAAACTTGATAAGGATGGAGTACCTAAAAGCA
GAGGTATTGGATTCATAGAATTTAATACACATGAATAAGCACTTTCATTCTTGGAATATT
GTGTAAATGATAAGCAAAACTTTGAAAAGAAATACAAGAAAACACCTATTATTGAGTTTT
CAATTGAAGATGCTAGAAAAATGGCAAAAAAGAATAAATTATTAGAAAAAGTTAAATAAA
AATAAGCAGAAAAGAAGAAAGAAAAGAAAGAATTAACTGAAGAGGAATTAGAATCAAAGA
AAAAAATTCTTAAAAATACGAACGAAGCAGCAAAAATAAAGATTTAAAATATTCTTGATT
AATCTAACTGCAGTGACATGTCTCTTTATGAGGAAGGCAAGAAATTGTTGAAGGACATAA
AGAGTAGAGGTATTAAATAAAGAATGGCCAAGCTACTAAGAAAGAAGTTCAATATTCAAA
ATGAAGATAATCAAAAGTCTAATAAATTAGTAGAAGCTATTTCCAAACAAGAGGAAAAGA
TCAAAAATAAGAATTCTAAGGAAGAAAAGAGAAAGCAATTATTGAAGTAGAAAGTATAAG
AAGAAAAGAAGTAGAAAGTAGCTGAATAAAAGAAGAAGCAAAAGGAAATCGATGATGAGC
TTGATGTTGATGCATCTGAACTTATTAAGGTAAATAATTAAACATTTTACTTAAGAATAT
TTATTGATTAATTTTAATTATTGTTTTATTAAAGGCTGTCTCTAAAGAATTAAAGAAAAA
TAAAATAAGAAGATAAAACTTGGAAGACTACGATGAATTAGATGTAAATTTTTAATAAAT
TTATTATTTTTTAAAATTATTTAATGTTAATAGGATGTAGTTGAAAAGCATATGTAAAAG
AAAGTTAAAAAAATAAAGCAAGAAAGTAGTGCATTGTGA