Identifiers and Description

Gene Model Identifier

TTHERM_00161740

Standard Name

RRM4 (RNA recognition motif-containing protein 4)

Aliases

PreTt28564 | 13.m00523 | 3829.m01385

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05172 ) MPPN (rrm-like) domain
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( PF08648 ) Protein of unknown function (DUF1777)
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( PF03011 ) Plasmodium falciparum erythrocyte membrane protein
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00161740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05423.16.998750589667296e-179hypothetical protein (531 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00161740(coding)
ATGACAACATTAGAGACATCAGTTTTAAGCGACGAGCAACAGCAGTAGATTTTGCATAAC
TAAACAAGTAATAGTAACTACAATAACGAAGGAGCTCTGAAAGGTTAAAATATATAATAG
GATACCCCAGCTAATGAAAACGATCAAAAAGAGAGGAAGCGATCACCTAGTAATAGAAAA
CATAAGAAGGAGAAGGATCACAAGAAAAAAGACAGAAAAAGTGAGAAGGATAGAAGAAGT
CGCAGTAACTCAGAAAAAAAGAAAAGAGATGAAAAATCTAAAAAAAGAAGGTCTTCTTCT
CGCGATCAAAGAAAGTCAAAGAGTGACAAAGATAGAAGTAGCTCTCGTCACCGTAGCAAA
AGAGAAAAAGATAGAAAGAAAAGCTCTAGTAGAAAGAGACATTCATCAAGAAGCAAGAGA
GATAAATCAAGGAAAAGACATGATAGCAGCAAAAGAAAAAGAAGACATCACTCTTCGTCT
TCATCTTCTTCTTCATCCTCTTAATCTTCTTCGGATAGGTCCAGATCTCGCAGAAGAAGA
CGTTCTTCATCTTTAAATAAAAAGAAACTGAGCGAAGCTGAACTGAGAAGACTTGAAAGA
GAAAAAAGAAATTTAGGAGAATATTACTCATAGCTTAAAAATTCAAGTAGGAGCAAGGAA
AGAAAGAAAAAAAACAAAGAAAACGATAAATTCTGTGATAGTAATAATATGCAAGTAGAC
ACTGAGAAATTCTTTTATGATGGATTTTAATGGTTGCCTAGAATATCTAAAAATAATAGG
CCTGATGAAATTACTCTAAAGCAAACAGAAAAGCAGCGTAAGATTTAACTTCAAAATGTT
CCTCTTGAGTTAGGATTAGATAAATTAGATATTATAAGTTATATCAATCACTTTATGAAG
GAAAAGCATTTAGCCAATGATGGTAATGACAATCCTGTCATAGATTGTGAAATAAATGAA
GAAAATAAAACTGCAAATATTGAATTTTCTTCTGTTGAGGAAACTAATTTAATGTATAAA
CTTGGCTCATTTTAATTCTTTTAAACAGAATGCAAGCTTTTCAGAATTTGTGATAATCAT
TTAACTTAACCAAGTGTAGCAGCTCTTACTCAGCTAGCTATAAGAGAAGCCGAAGTCGCA
GCATAGCTTATCAAAGTCACTGAAAATTTATTCTAAGACAGTGGTGATGATAAAAATAAA
AATAAAAAAACTGATTTAATATCTACAATTATTAAAGTAACTAACACAATCAAATTAGGA
ACTGAGGGCGAATTAACTGAAGAAAATTGGTAAGATTTGCATGCTGATTTACTTGAAGAA
TTTGAAAGATATGGCACAATTGAATTCCATTTTATTATTAGGCCATATTAAGCAACTGTA
GGAGCAAAAGCAGGTACTTTATTTGTATAGTATGCTACTAAAGAAGCAGTATAATTAGCG
ATTTAAACAAACTAAGGCAGATTATTTAATGGATAGAGCTTAAAAATATACAACATCCCA
GAATAAGGATTTAATTTAAACTTTAGACCCTTGTTACAAGTTCGTTGA


>TTHERM_00161740(protein)
MTTLETSVLSDEQQQQILHNQTSNSNYNNEGALKGQNIQQDTPANENDQKERKRSPSNRK
HKKEKDHKKKDRKSEKDRRSRSNSEKKKRDEKSKKRRSSSRDQRKSKSDKDRSSSRHRSK
REKDRKKSSSRKRHSSRSKRDKSRKRHDSSKRKRRHHSSSSSSSSSSQSSSDRSRSRRRR
RSSSLNKKKLSEAELRRLEREKRNLGEYYSQLKNSSRSKERKKKNKENDKFCDSNNMQVD
TEKFFYDGFQWLPRISKNNRPDEITLKQTEKQRKIQLQNVPLELGLDKLDIISYINHFMK
EKHLANDGNDNPVIDCEINEENKTANIEFSSVEETNLMYKLGSFQFFQTECKLFRICDNH
LTQPSVAALTQLAIREAEVAAQLIKVTENLFQDSGDDKNKNKKTDLISTIIKVTNTIKLG
TEGELTEENWQDLHADLLEEFERYGTIEFHFIIRPYQATVGAKAGTLFVQYATKEAVQLA
IQTNQGRLFNGQSLKIYNIPEQGFNLNFRPLLQVR


>TTHERM_00161740(gene)
ATGACAACATTAGAGACATCAGTTTTAAGCGACGAGCAACAGCAGTAGATTTTGCATAAC
TAAACAAGTAATAGTAACTACAATAACGAAGGAGCTCTGAAAGGTTAAAATATATAATAG
GATACCCCAGCTAATGAAAACGATCAAAAAGAGAGGAAGCGATCACCTAGTAATAGAAAA
CATAAGAAGGAGAAGGATCACAAGAAAAAAGACAGAAAAAGTGAGAAGGATAGAAGAAGT
CGCAGTAACTCAGAAAAAAAGAAAAGAGATGAAAAATCTAAAAAAAGAAGGTCTTCTTCT
CGCGATCAAAGAAAGTCAAAGAGTGACAAAGATAGAAGTAGCTCTCGTCACCGTAGCAAA
AGAGAAAAAGATAGAAAGAAAAGCTCTAGTAGAAAGAGACATTCATCAAGAAGCAAGAGA
GATAAATCAAGGAAAAGACATGATAGCAGCAAAAGAAAAAGAAGACATCACTCTTCGTCT
TCATCTTCTTCTTCATCCTCTTAATCTTCTTCGGATAGGTCCAGATCTCGCAGAAGAAGA
CGTTCTTCATCTTTAAATAAAAAGAAACTGAGCGAAGCTGAACTGAGAAGACTTGAAAGA
GAAAAAAGAAATTTAGGAGAATATTACTCATAGCTTAAAAATTCAAGTAGGAGCAAGGAA
AGAAAGAAAAAAAACAAAGAAAACGATAAATTCTGTGATAGTAATAATATGCAAGTAGAC
ACTGAGAAATTCTTTTATGATGGATTTTAATGGTTGCCTAGAATATCTAAAAATAATAGG
CCTGATGAAATTACTCTAAAGCAAACAGAAAAGCAGCGTAAGATTTAACTTCAAAATGTT
CCTCTTGAGTTAGGATTAGATAAATTAGATATTATAAGTTATATCAATCACTTTATGAAG
GAAAAGCATTTAGCCAATGATGGTAATGACAATCCTGTCATAGATTGTGAAATAAATGAA
GAAAATAAAACTGCAAATATTGAATTTTCTTCTGTTGAGGAAACTAATTTAATGTATAAA
CTTGGCTCATTTTAATTCTTTTAAACAGAATGCAAGCTTTTCAGAATTTGTGATAATCAT
TTAACTTAACCAAGTGTAGCAGCTCTTACTCAGCTAGCTATAAGAGAAGCCGAAGTCGCA
GCATAGCTTATCAAAGTCACTGAAAATTTATTCTAAGACAGTGGTGATGATAAAAATAAA
AATAAAAAAACTGATTTAATATCTACAATTATTAAAGTAACTAACACAATCAAATTAGGA
ACTGAGGGCGAATTAACTGAAGAAAATTGGTAAGATTTGCATGCTGATTTACTTGAAGAA
TTTGAAAGATATGGCACAATTGAATTCCATTTTATTATTAGGCCATATTAAGCAACTGTA
GGAGGTAAATTTATTTTAATTTTTATTAAAATTAATCATTTTTTTTTATAAAAACAGCAA
AAGCAGGTACTTTATTTGTATAGTATGCTACTAAAGAAGCAGTATAATTAGCGATTTAAA
CAAACTAAGGCAGATTATTTAATGGATAGAGCTTAAAAATATACAACATCCCAGAATAAG
GATTTAATTTAAACTTTAGACCCTTGTTACAAGTTCGTTGA