Identifiers and Description

Gene Model Identifier

TTHERM_00655870

Standard Name

RRM39 (RNA recognition motif-containing protein 39)

Aliases

PreTt03681 | 96.m00150

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08675 ) RNA binding domain
  • ( TIGR01649 ) hnRNP-L/PTB/hephaestus splicing factor family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00655870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18022.19.997093137033517e-262polypyrimidine tract-binding p
rotein (871 aa)
WormBaseWBGene000042070.000000000010004361180063202locus:ptb-1 status:Confirmed
UniProt:Q8T3E6 protein_id
:CAD30435.1
DictyBaseDDB_G02843210.0000000029989608248573072DDB_G0284321 on chromosome: 4
position 1760065 to 1764027
OxytrichaContig511.0.0.g10.00000030014504373857585RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
SGDYIR009W0.000030009396760408108MSL1 U2B component of U2 snRNP
, involved in splicing, binds
the U2 snRNA stem-loop IV in v
itro but requires association
of Lea1p for in vivo binding;
does not contain the conserved
C-terminal RNA binding domain
found in other family members

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00655870(coding)
ATGTCTTAGGCAAATAAACTTCAAAAATCGCAGCCTGTTCAAATATAATAGCACTTAAAC
GGAAATCAAGCCAAGCAATCGTTATCTTCAGTTATGCAGTAGCAGCAATAAAAAATAAGT
GCTTAAGAATAGTCTTTGAAAAATGAAGATTAGGCTATGCACAGAACCCACATGAAGGCT
AATACAATCGAAAATCTATCACCTGTGTTACTTGTAATTTTCAATACTAACGAAGCTAAG
ACAAACTAGGATCTCTTTGACATGTTTTCGTCTTATGTGAGAGTGATTCGTGTTTTAATA
TTTGAAAGAAAAGAAAATAATACAAAGTGCTTTGTCGAAATGATGACATAATCTGAGGCT
ACTTATGTAAAAAACTAAATTTCCTTCTAGAAGACTAAGAATTTGTTAAAAAATTTACAA
GTTTATTATGCTTAAATCTCAACAATCGACTTGTAAAACCATTATTCAGAAGGCTAAGAC
TTTACTAGCTTCTATGCAACTCATCCTAATTTCACTTGTTAATACATTTAGGAAACTTAA
TAATACTCTCAGAACCCTATTTTGTAAAACAGCACCATCAACCCCAAATTAAGCAGTCAA
GCAGCTTTTTAAAATAGCTTCTTAAACCCAGGCAAAAATAATGTTCAATAATCTATTAAC
AGTCCTTCAGCTTTTTATAACAATTATAACCCAAATAACTAAAGTTTTGCTGGTCCTGCT
AATAATAAAACTGCAGGATTTGGAGCTCCTTACGTTAATTCTTAGCAATTTTTACCTAAT
CATGTACCAGCTGAAATGGACAATAATTTCGATTAATCACATTTTCTAGATGGATAAATT
CGTCCAAGCTCTATTTCTTCTATTGATTATCAAATGCAGTCAAATTTACATTTATCTCAA
TACAATCATACTTCAATTCACCCTCATTCTCAATACACCACCAATGGCGGTAACAGCGGT
AATCTAACAAGCAGACACACCATTCACGGAAATCCTAATATGCAACCTAATAACACTCCA
TTCGAATCCAAAATTTATTACACAACTCAATAGCCTCAACAATAGCAAAATATTAATTAA
CGCAACACTATGTCTTAATAGCTTTACAGAGATTTGCAAAAGAAGGAATAAGTTTTATCG
CATCACATTAATTAAAATATGTAGCAAAATATGCAAAAATCCGCTCTTCTTCTATCACCT
TATTTCAATGTCACTCCTGGCATAAATAAGCCAGAGATGATAAACAATCCACCTCCTATT
TCCTTGAACAGTAGCACTAACAGGAGTCCTTCATCCACCTCTTACTCAATAAATAACAAC
AACTTAAATAATGCTAATCAAATATAATATGACTCTGATGTTGATGAAAATGTCTAAGTC
AGTTAACCTTCAGCATTCAGAACTAAGTATCGTGATGTCTAATTTTTCAATGGCAACTCC
AGCAACGTAGGCTATTTAGAAGATGTTGATCTTTAGTAATAGCAAATGGGAGCTGACTAA
GAGGCTAAAAAAGTTCTATTTGTTAGACATCTTGACTTTCCTGATTTAAAAATATCTATG
CTTTATAACCTTTTTAGCAATTATGGAAATATTGTGAAAATTATTTTCATGAAGCAGAAG
AGACAAGCTCTGATAGAATTCGAAGAAACTTCATAAGCAACCGCAGCCAAAGAAAATTTA
AACAACTTGCCATACTACAATGCTTAAATTAAAATAGATTACTCCAAATATGACCAAATA
GACCTCCAAAAGAAGAAACTTCATTCTGGAGAAAATAACGAACAAGAATAAGTCCTGTAA
ATCCCTCAATAATGCTTCAGATATAAAAATAAAAAGGGAATTCCGCAGTACGCTCCTAAA
AGCACTCTCCATGTTTCTAACATCAAAAAAGAATTCTTCGACTACAACCTAATTTAAGAT
TTCTTTTCTTCTTCAGGTGCAAAAATAAAGATGCTAAAACTCATTCCTAATGAAAAAAAG
TAAATGTGTCTAATTCAATTTGAAACCCTTGATGATGCTCTAAGAGTAATATCAACTTTC
CACGATACACCTTTCCATGGTAGAAACCTGTGCATTTCATTCACGAAGAGTGCAAACTCA
ATATAGTAAGCTCCTGGATAATAAAATAATATCAATACTAACTTCTCTAGCTCTAATAAC
ATGAGCAACAATTTAGAATAATAATAGTAAATACTTATGAAATAGCAATAACAAATGCAA
AATTAACAATATAATATCAACATTTTGAACTAAAATTAACTTCTTATTTAACAATAGCAA
TATTAGAATCCCTAATATGGTCAAAACAACACATTCTAAATCAATAACTTTGCCAATAAT
AACAACAATACTCATGGACTTGCTGCTCAACAGTCAACTTTGTTTGGTTACGATCTTAGT
GATAACAATTATCACCAATACTATGATGAATACAATGACAGTGATGAAGATCCTTAAGTG
ACTAATTCTATTTAGAACTTAGGTATTTGA


>TTHERM_00655870(protein)
MSQANKLQKSQPVQIQQHLNGNQAKQSLSSVMQQQQQKISAQEQSLKNEDQAMHRTHMKA
NTIENLSPVLLVIFNTNEAKTNQDLFDMFSSYVRVIRVLIFERKENNTKCFVEMMTQSEA
TYVKNQISFQKTKNLLKNLQVYYAQISTIDLQNHYSEGQDFTSFYATHPNFTCQYIQETQ
QYSQNPILQNSTINPKLSSQAAFQNSFLNPGKNNVQQSINSPSAFYNNYNPNNQSFAGPA
NNKTAGFGAPYVNSQQFLPNHVPAEMDNNFDQSHFLDGQIRPSSISSIDYQMQSNLHLSQ
YNHTSIHPHSQYTTNGGNSGNLTSRHTIHGNPNMQPNNTPFESKIYYTTQQPQQQQNINQ
RNTMSQQLYRDLQKKEQVLSHHINQNMQQNMQKSALLLSPYFNVTPGINKPEMINNPPPI
SLNSSTNRSPSSTSYSINNNNLNNANQIQYDSDVDENVQVSQPSAFRTKYRDVQFFNGNS
SNVGYLEDVDLQQQQMGADQEAKKVLFVRHLDFPDLKISMLYNLFSNYGNIVKIIFMKQK
RQALIEFEETSQATAAKENLNNLPYYNAQIKIDYSKYDQIDLQKKKLHSGENNEQEQVLQ
IPQQCFRYKNKKGIPQYAPKSTLHVSNIKKEFFDYNLIQDFFSSSGAKIKMLKLIPNEKK
QMCLIQFETLDDALRVISTFHDTPFHGRNLCISFTKSANSIQQAPGQQNNINTNFSSSNN
MSNNLEQQQQILMKQQQQMQNQQYNINILNQNQLLIQQQQYQNPQYGQNNTFQINNFANN
NNNTHGLAAQQSTLFGYDLSDNNYHQYYDEYNDSDEDPQVTNSIQNLGI


>TTHERM_00655870(gene)
ATGTCTTAGGCAAATAAACTTCAAAAATCGCAGCCTGTTCAAATATAATAGCACTTAAAC
GGAAATCAAGCCAAGCAATCGTTATCTTCAGTTATGCAGTAGCAGCAATAAAAAATAAGT
GCTTAAGAATAGTCTTTGAAAAATGAAGATTAGGCTATGCACAGAACCCACATGAAGGCT
AATACAATCGAAAATCTATCACCTGTGTTACTTGTAATTTTCAATACTAACGAAGCTAAG
ACAAACTAGGATCTCTTTGACATGTTTTCGTCTTATGTGAGAGTGATTCGTGTTTTAATA
TTTGAAAGAAAAGAAAATAATACAAAGTGCTTTGTCGAAATGATGACATAATCTGAGGCT
ACTTATGTAAAAAACTAAATTTCCTTCTAGAAGACTAAGAATTTGTTAAAAAATTTACAA
GTTTATTATGCTTAAATCTCAACAATCGACTTGTAAAACCATTATTCAGAAGGCTAAGAC
TTTACTAGCTTCTATGCAACTCATCCTAATTTCACTTGTTAATACATTTAGGAAACTTAA
TAATACTCTCAGAACCCTATTTTGTAAAACAGCACCATCAACCCCAAATTAAGCAGTCAA
GCAGCTTTTTAAAATAGCTTCTTAAACCCAGGCAAAAATAATGTTCAATAATCTATTAAC
AGTCCTTCAGCTTTTTATAACAATTATAACCCAAATAACTAAAGTTTTGCTGGTCCTGCT
AATAATAAAACTGCAGGATTTGGAGCTCCTTACGTTAATTCTTAGCAATTTTTACCTAAT
CATGTACCAGCTGAAATGGACAATAATTTCGATTAATCACATTTTCTAGATGGATAAATT
CGTCCAAGCTCTATTTCTTCTATTGATTATCAAATGCAGTCAAATTTACATTTATCTCAA
TACAATCATACTTCAATTCACCCTCATTCTCAATACACCACCAATGGCGGTAACAGCGGT
AATCTAACAAGCAGACACACCATTCACGGAAATCCTAATATGCAACCTAATAACACTCCA
TTCGAATCCAAAATTTATTACACAACTCAATAGCCTCAACAATAGCAAAATATTAATTAA
CGCAACACTATGTCTTAATAGCTTTACAGAGATTTGCAAAAGAAGGAATAAGTTTTATCG
CATCACATTAATTAAAATATGTAGCAAAATATGCAAAAATCCGCTCTTCTTCTATCACCT
TATTTCAATGTCACTCCTGGCATAAATAAGCCAGAGATGATAAACAATCCACCTCCTATT
TCCTTGAACAGTAGCACTAACAGGAGTCCTTCATCCACCTCTTACTCAATAAATAACAAC
AACTTAAATAATGCTAATCAAATATAATATGACTCTGATGTTGATGAAAATGTCTAAGTC
AGTTAACCTTCAGCATTCAGAACTAAGTATCGTGATGTCTAATTTTTCAATGGCAACTCC
AGCAACGTAGGCTATTTAGAAGATGTTGATCTTTAGTAATAGCAAATGGGAGCTGACTAA
GAGGCTAAAAAAGTTCTATTTGTTAGACATCTTGACTTTCCTGATTTAAAAATATCTATG
CTTTATAACCTTTTTAGCAATTATGGAAATATTGTGAAAATTATTTTCATGAAGCAGAAG
AGACAAGCTCTGATAGAATTCGAAGAAACTTCATAAGCAACCGCAGCCAAAGAAAATTTA
AACAACTTGCCATACTACAATGCTTAAATTAAAATAGATTACTCCAAATATGACCAAATA
GACCTCCAAAAGAAGAAACTTCATTCTGGAGAAAATAACGAACAAGAATAAGTCCTGTAA
ATCCCTCAATAATGCTTCAGATATAAAAATAAAAAGGGAATTCCGCAGTACGCTCCTAAA
AGCACTCTCCATGTTTCTAACATCAAAAAAGAATTCTTCGACTACAACCTAATTTAAGAT
TTCTTTTCTTCTTCAGGTGCAAAAATAAAGATGCTAAAACTCATTCCTAATGAAAAAAAG
TAAATGTGTCTAATTCAATTTGAAACCCTTGATGATGCTCTAAGAGTAATATCAACTTTC
CACGATACACCTTTCCATGGTAGAAACCTGTGCATTTCATTCACGAAGAGTGCAAACTCA
ATATAGTAAGCTCCTGGATAATAAAATAATATCAATACTAACTTCTCTAGCTCTAATAAC
ATGAGCAACAATTTAGAATAATAATAGTAAATACTTATGAAATAGCAATAACAAATGCAA
AATTAACAATATAATATCAACATTTTGAACTAAAATTAACTTCTTATTTAACAATAGCAA
TATTAGAATCCCTAATATGGTCAAAACAACACATTCTAAATCAATAACTTTGCCAATAAT
AACAACAATACTCATGGACTTGCTGCTCAACAGTCAACTTTGTTTGGTTACGATCTTAGT
GATAACAATTATCACCAATACTATGATGAATACAATGACAGTGATGAAGATCCTTAAGTG
ACTAATTCTATTTAGAACTTAGGTATTTGA