Identifiers and Description

Gene Model Identifier

TTHERM_00600630

Standard Name

RRM38 (RNA recognition motif-containing protein 38)

Aliases

PreTt22126 | 83.m00195 | 3685.m00087

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04702 ) Vicilin N terminal region
  • ( PF04950 ) Protein of unknown function (DUF663)
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00600630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14920.19.997093137033517e-262RNA recognition domain-contain
ing protein domain-containing
protein (942 aa)
Stentor CoeruleusSteCoe_217980.00000000027894680928689246
OxytrichaContig1235.1.g1240.000000009000371344152433RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
SGDYER165W0.0004999512321494991PAB1 Poly(A) binding protein,
part of the 3-end RNA-processi
ng complex, mediates interacti
ons between the 5 cap structur
e and the 3 mRNA poly(A) tail,
involved in control of poly(A
) tail length, interacts with
translation factor eIF-4G

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00600630(coding)
ATGAGTTAAGGCGAAGAAACTTTCAAAAGCTTATCTGCCGCATTGGAAGGCTTGAAAAAC
AGTCAATCTCTAGCATACTTTTAGTAATAGAATGCTGATCCTTACAATTAAATGCATAAA
TAAAAAAATACCTACAACAGCAATTATCTTACACAAGATGAGTAGAATCTTCATTATCTT
GAGGATTCTCCTGAGCCAGAGCATTTTGAATTCTAGAATGTGAACGACCCTCATGAATAA
CTTAACTAGATGTATCAAAGTAGATAAATCTATAAGTAGCAATAATAGGGTGCAGGATTT
TAGAGTTCTTAAAAGCCTTACTATAAAAATAACTATGAAGGTACCCAAGGTAGTCATAGA
TAGTATAATAATCCATAATCTTATAACTAAGCTGCTTAAAGTCACACTAATGGTTATCAA
GGTTAAAGAGTATCTAATTACAACAGATATCAAGGCTAGCAAACTGGCTATTAAGGATAA
AACTATATTCCTAATGAAAGAAACTTTTCACAAGGAGCAAAATATCAAGGTTAAAAACCT
CCAGGCGCTTTTAATGCTCATCATTAGAACCAATTTAACAACCAAAATTCGCAATAGCAA
GGATAACAATATCATGGTCATTCAAATACATTCCCCTAAGGAGAAAAGTCAGCAGGTGGT
ATTCATATTGAAGGTACAAAGATATTTATAAATAATATTGAACCCACTGTGAGCTAAGAA
GAAATTCACCACTATTTTGATCCTTATGGAAAGATCAATGATTTAAAAGTATTCCACAGA
AATGGGTAAAACTATGCTTATGTTATTTTTGAGAAGTACGAAGACGCTTTCAGAGCAACT
AATGATGTTTCTCCCTAACCTAATTGGACAGTATCATTAGCTAAGTCAAAGAACACAGTT
ATGCAGTATCAAAGATCAACACTTTTCGAATAAGATGGTTAAAATCCTAATCCTCCATAT
ACAGGCACAAGCAAATATAATAATCCTGCAGGAAATCCACCTCATTTCAAAAAGCCATTT
AATAAATATTAATAAAATCCTAACATACAAAACCAACATCCAAATCCAAGATATGAAAAA
TCTGCAGGCACCAACTTTAGCCAAAACTAGTATGAATCATCTAATGGGGAAAAAATTCTT
TAAAATATCAGTAATTTCAATGATAATAATGCAAATGGTCATAATAACTTAGGAGAAGTT
CTTTCCAACCATAAAACTTAAATTAACTAAACTATCTTAGTTAGAGAAATCTGGGTGAGC
AACATAGATGAAAAGTGCAAGCCTTATATTAGAGAAATTATTGAAGACTTCTTTGGAGGT
ATAGAAGAGGTAGAGTTCTTTGATAGAGGCAAAGACTCTTTTGCATTTATAAAATTTTTT
ATGGTTTAAACTGCTTATTTAGCTTTTACAAATAAGGAAAAAATTGCAGAACTTCTTGAG
ACAGATTAAGTAAAATTAACATACTCTGATCCTTCTAGAAGAAAAAATATCATTGGTGAT
CACGAAGATTATATGAGAGATGAAAATTTATCTCCTGTTTTGTATATCAGTTTCCCTTAT
GGTTTCAAAGTGAAAAAAAGTGTCATCTAAAAAATTGCCAGTGACTACGGAACAGTATTA
AACGTTACTTTGAAGAGAAGTGAAGATCCTAAATAAACTTCCAGTGTTTTAGTAGAATTC
TAGGATTTAAAAGATGCTAAATTTGCTTTCAAACATATGAGAGAAGATCATGATAAGATG
CATCCTAAATGTGAATTTGCAATTTTGCTCAATTCTGAAAAGTTTGTTAAAGAAAACAAT
TTAAAACTCAAAGAAAAAATCAAACCTACTGTATTACCTGGGTAAGCACCAACAACTACT
TTCATTTAGTAAAAGCCTTTAGCTAGAAAACCTATTAATATAAATGAAAACGCTAATAAT
GCTTTATCAGATATAGCTGGTATTCGAATTTAAAAGTAACTTTAGTCCAAAGGAAGATAG
TTTTCTCCTGAAAAAGATGCTGAAATAAATTAAAAACGTACTTATAATTAATTCAAGCAA
AGTTCTTTAAATACAAGCTAGGATTAAGGTTATAATCCGGATGAGTAAGATGCAGAATTA
CTTGTAGAAGACGACGATGATGAAAATTTCATTTGGTCTGGTTTCATTTCAATTAATAAA
AAGGGTAGATGTGGTATGGATGCAAAAGTAATCTAAAGCCAAGGCTAATTAGATCTTGAT
ACTTATAATCTCGTGATGACTACTAAATGTTAGCTTTCTGAGCCCTTGAGATATCCCCCT
TATTCAGTACTTATATTTAGACCTTCAAACGAAACAGAAAAGAAACCTTTCAAAGATGTT
AAAACATTTTTGAATAGCAACCCTAATTAAGCTGGTGTAATTCACACTAAAAATCTTATA
ATTTATATGTTCCCATCTAATGAGTAAGCCTTAAAATTCTACCCTCAACTCAAAGAAGGA
AATATTTTAGCTCTATGTCACAACCAAGACTCTATCAGAGGGAATTTATCAAAGAAAGAA
GGAAAGTATGATGAAAAATTGTAAGCAAGATAAAAAGCTGCTTTGAATGATTCACATGAG
GATGACGAAGAAGATAATATGATTTATGATCCTACATCTATCTTACAAGATACATCAAAA
TATAATGGTAAAAAAGGTTAATAACAACACAGATATGAACATGATGAAGACAACTAATAC
TAAGAAGAAAATATTTATGATCCAAACAAAATAAATATGTAAAAAGATGATCCAAAAACT
GATATTTCTGACTTAATAGATAATCCCTCACTTATGGATAGCATGTTGAAGAGTTTGTAT
TGA


>TTHERM_00600630(protein)
MSQGEETFKSLSAALEGLKNSQSLAYFQQQNADPYNQMHKQKNTYNSNYLTQDEQNLHYL
EDSPEPEHFEFQNVNDPHEQLNQMYQSRQIYKQQQQGAGFQSSQKPYYKNNYEGTQGSHR
QYNNPQSYNQAAQSHTNGYQGQRVSNYNRYQGQQTGYQGQNYIPNERNFSQGAKYQGQKP
PGAFNAHHQNQFNNQNSQQQGQQYHGHSNTFPQGEKSAGGIHIEGTKIFINNIEPTVSQE
EIHHYFDPYGKINDLKVFHRNGQNYAYVIFEKYEDAFRATNDVSPQPNWTVSLAKSKNTV
MQYQRSTLFEQDGQNPNPPYTGTSKYNNPAGNPPHFKKPFNKYQQNPNIQNQHPNPRYEK
SAGTNFSQNQYESSNGEKILQNISNFNDNNANGHNNLGEVLSNHKTQINQTILVREIWVS
NIDEKCKPYIREIIEDFFGGIEEVEFFDRGKDSFAFIKFFMVQTAYLAFTNKEKIAELLE
TDQVKLTYSDPSRRKNIIGDHEDYMRDENLSPVLYISFPYGFKVKKSVIQKIASDYGTVL
NVTLKRSEDPKQTSSVLVEFQDLKDAKFAFKHMREDHDKMHPKCEFAILLNSEKFVKENN
LKLKEKIKPTVLPGQAPTTTFIQQKPLARKPININENANNALSDIAGIRIQKQLQSKGRQ
FSPEKDAEINQKRTYNQFKQSSLNTSQDQGYNPDEQDAELLVEDDDDENFIWSGFISINK
KGRCGMDAKVIQSQGQLDLDTYNLVMTTKCQLSEPLRYPPYSVLIFRPSNETEKKPFKDV
KTFLNSNPNQAGVIHTKNLIIYMFPSNEQALKFYPQLKEGNILALCHNQDSIRGNLSKKE
GKYDEKLQARQKAALNDSHEDDEEDNMIYDPTSILQDTSKYNGKKGQQQHRYEHDEDNQY
QEENIYDPNKINMQKDDPKTDISDLIDNPSLMDSMLKSLY


>TTHERM_00600630(gene)
ATGAGTTAAGGCGAAGAAACTTTCAAAAGCTTATCTGCCGCATTGGAAGGCTTGAAAAAC
AGTCAATCTCTAGCATACTTTTAGTAATAGAATGCTGATCCTTACAATTAAATGCATAAA
TAAAAAAATACCTACAACAGCAATTATCTTACACAAGATGAGTAGAATCTTCATTATCTT
GAGGATTCTCCTGAGCCAGAGCATTTTGAATTCTAGAATGTGAACGACCCTCATGAATAA
CTTAACTAGATGTATCAAAGTAGATAAATCTATAAGTAGCAATAATAGGGTGCAGGATTT
TAGAGTTCTTAAAAGCCTTACTATAAAAATAACTATGAAGGTACCCAAGGTAGTCATAGA
TAGTATAATAATCCATAATCTTATAACTAAGCTGCTTAAAGTCACACTAATGGTTATCAA
GGTTAAAGAGTATCTAATTACAACAGATATCAAGGCTAGCAAACTGGCTATTAAGGATAA
AACTATATTCCTAATGAAAGAAACTTTTCACAAGGAGCAAAATATCAAGGTTAAAAACCT
CCAGGCGCTTTTAATGCTCATCATTAGAACCAATTTAACAACCAAAATTCGCAATAGCAA
GGATAACAATATCATGGTCATTCAAATACATTCCCCTAAGGAGAAAAGTCAGCAGGTGGT
ATTCATATTGAAGGTACAAAGATATTTATAAATAATATTGAACCCACTGTGAGCTAAGAA
GAAATTCACCACTATTTTGATCCTTATGGAAAGATCAATGATTTAAAAGTATTCCACAGA
AATGGGTAAAACTATGCTTATGTTATTTTTGAGAAGTACGAAGACGCTTTCAGAGCAACT
AATGATGTTTCTCCCTAACCTAATTGGACAGTATCATTAGCTAAGTCAAAGAACACAGTT
ATGCAGTATCAAAGATCAACACTTTTCGAATAAGATGGTTAAAATCCTAATCCTCCATAT
ACAGGCACAAGCAAATATAATAATCCTGCAGGAAATCCACCTCATTTCAAAAAGCCATTT
AATAAATATTAATAAAATCCTAACATACAAAACCAACATCCAAATCCAAGATATGAAAAA
TCTGCAGGCACCAACTTTAGCCAAAACTAGTATGAATCATCTAATGGGGAAAAAATTCTT
TAAAATATCAGTAATTTCAATGATAATAATGCAAATGGTCATAATAACTTAGGAGAAGTT
CTTTCCAACCATAAAACTTAAATTAACTAAACTATCTTAGTTAGAGAAATCTGGGTGAGC
AACATAGATGAAAAGTGCAAGCCTTATATTAGAGAAATTATTGAAGACTTCTTTGGAGGT
ATAGAAGAGGTAGAGTTCTTTGATAGAGGCAAAGACTCTTTTGCATTTATAAAATTTTTT
ATGGTTTAAACTGCTTATTTAGCTTTTACAAATAAGGAAAAAATTGCAGAACTTCTTGAG
ACAGGTAAATATTTATTCTTCATAACATATTATTTTATTTTTATGAATCTGAAAAATTCA
AACAAATTTGATTTTTTCACCATTTCAATATCTATCTATCCTAAATAAAAATCCCTATTA
AAAAATCAAAATAAAATTCAAAAAATATAAAGATAAGAAATTAAAAAGAAAAGAAAAAAT
AAATCAAATCTAAAATTCGCGCGTAATAAAATAAATTAAAAATAATAAGAAAGTAAATCA
TAAATCTATAAAAAAGAAATAATAATAATAATAATAATTATAATAATAAATAAAACTCTT
ATCTGAAATTTAAAAGACAATCAAAAGAAAAATATTGGGGAATATCAAACCATAAATAAA
TAAATAAATAAATAAATAAACAAAAAAATAAAGACAAACGGGGGAATCATTTATGAATAA
TAAAATCTAATAAATACTAAATTTAAAAAAGATCATTTATATAAAGTTTTACAAAAGATA
AAAAATATCATCAACAAAAATAAAAATTTTACATTAGAATTTTACTTTCAAAAATTTTTA
AATAAAACTAAATGAAATTTAAATCAAATTTGTTAAAAAGACTTTATAAAAAGATAACAA
ACAAACATGATTTGTAAAATTAAATAACAGAAATGTGATAATTTTCTTAAGTAAAATATT
AATAAAATAATAAAACTTTAAGTGTGATATTTATTAATTAATTAATCAATATGAAAATCC
ATAGTTACAAAAATAAAAAATAATTTACCTAAAATCAAATAACACACACAACCAATTGTT
GGATGAATTTAATTTAAATTATAAAAATATAATTTAACTATTATAAAATATAAATTAAAA
TATAGATTAAGTAAAATTAACATACTCTGATCCTTCTAGAAGAAAAAATATCATTGGTGA
TCACGAAGATTATATGAGAGATGAAAATTTATCTCCTGTTTTGTATATCAGTTTCCCTTA
TGGTTTCAAAGTGAAAAAAAGTGTCATCTAAAAAATTGCCAGTGACTACGGAACAGTATT
AAACGTTACTTTGAAGAGAAGTGAAGATCCTAAATAAACTTCCAGTGTTTTAGTAGAATT
CTAGGATTTAAAAGATGCTAAATTTGCTTTCAAACATATGAGAGAAGATCATGATAAGAT
GCATCCTAAATGTGAATTTGCAATTTTGCTCAATTCTGAAAAGTTTGTTAAAGAAAACAA
TTTAAAACTCAAAGAAAAAATCAAACCTACTGTATTACCTGGGTAAGCACCAACAACTAC
TTTCATTTAGTAAAAGCCTTTAGCTAGAAAACCTATTAATATAAATGAAAACGCTAATAA
TGCTTTATCAGATATAGCTGGTATTCGAATTTAAAAGTAACTTTAGTCCAAAGGAAGATA
GTTTTCTCCTGAAAAAGATGCTGAAATAAATTAAAAACGTACTTATAATTAATTCAAGCA
AAGTTCTTTAAATACAAGCTAGGATTAAGGTTATAATCCGGATGAGTAAGATGCAGAATT
ACTTGTAGAAGACGACGATGATGAAAATTTCATTTGGTCTGGTTTCATTTCAGTAATTAT
TTTTTCAAAACTTTAATAAACTAAATTTATTTAAAAATCTTTTAACAGATTAATAAAAAG
GGTAGATGTGGTATGGATGCAAAAGTAATCTAAAGCCAAGGCTAATTAGATCTTGATACT
TATAATCTCGTGATGACTACTAAATGTTAGCTTTCTGAGCCCTTGAGATATCCCCCTTAT
TCAGTACTTATATTTAGACCTTCAAACGAAACAGAAAAGAAACCTTTCAAAGATGTTAAA
ACATTTTTGAATAGCAACCCTAATTAAGCTGGTGTAATTCACACTAAAAATCTTATAATT
TATATGTTCCCATCTAATGAGTAAGCCTTAAAATTCTACCCTCAACTCAAAGAAGGAAAT
ATTTTAGCTCTATGTCACAACCAAGACTCTATCAGAGGGAATTTATCAAAGAAAGAAGGA
AAGTATGATGAAAAATTGTAAGCAAGATAAAAAGCTGCTTTGAATGATTCACATGAGGAT
GACGAAGAAGATAATATGATTTATGATCCTACATCTATCTTACAAGATACATCAAAATAT
AATGGTAAAAAAGGTTAATAACAACACAGATATGAACATGATGAAGACAACTAATACTAA
GAAGAAAATATTTATGATCCAAACAAAATAAATATGTAAAAAGATGATCCAAAAACTGAT
ATTTCTGACTTAATAGATAATCCCTCACTTATGGATAGCATGTTGAAGAGTTTGTATTGA