Identifiers and Description

Gene Model Identifier

TTHERM_00557810

Standard Name

RRM37 (RNA recognition motif-containing protein 37)

Aliases

PreTt07879 | 73.m00123 | 3735.m00017

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( TIGR01648 ) hnRNP-R, Q splicing factor family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00557810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14346.16.997264088033092e-153RNA binding protein (487 aa)
OxytrichaContig10739.0.g632.998863950472602e-38RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
SGDYBR212W9.998720540547892e-23NGR1 RNA binding protein that
negatively regulates growth ra
te; interacts with the 3 UTR o
f the mitochondrial porin (POR
1) mRNA and enhances its degra
dation; overexpression impairs
mitochondrial function; expre
ssed in stationary phase
WormBaseWBGene000159431.9991095569230066e-20locus:tiar-1 status:Confirme
d UniProt:Q95QV8 protein_i
d:CCD65015.1
DictyBaseDDB_G02907452.9992476920535046e-16pabpc1B on chromosome: 5 posit
ion 4494408 to 4497035
Stentor CoeruleusSteCoe_75810.00000000027894680928689246

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00557810(coding)
ATGAGCAATTTAGATTTAAGAACATTGTGGGTTGGAGATATTGAAAACTGGATGACTGAA
TAATTTATTGAAAGTGTTTTTAATAAAGTTGGTAAGGTTGTTAGCGTTAAGTTAATCAGA
ACAAAAGAAACAAGTCTCCCTGCTGGTTATTGCTTCGTTGAATTTTAGACTCATGAACAA
GCAGAAAGAATTTTGATGAATTACAACTAGTAGTTAATCCCTGGAACTCAAAATACCTTC
AGAATGAATTGGGGAAAGAACCCTACTAACACTGGTATTATCAAGCAACCTACAACCTAA
GCTAATAATGGTTATGGAAATAATTAATATGGCATGATGCAATAGCCAGTGATCTAAATG
CCACCTATTTAAGAATTCTCAATTTATGTTGGTGAATTAGAACTTGGCATTAACGAGTAA
CAACTTGCAGAGCACTTCAGATCTAAGTATTCTAGTGTAATTGGCTCTAAGATTATTACT
GAACCTACCAGCAAGATGAGCAAAGGTTACGGCTTTGTAAAGTTTTCTAATCCTATTGAA
GGACAACGTGCTATTCATGAAATGAATGGCTCTCTTTTTAAGGGCAAATTCATTAAGGTT
TCTCAAGCTGTTTCAAGGTAATAATAACAGGCTTAAGCTTAAGCTGCTGGAACACCTGGA
TTCCCTTAACCCGCAGGTTATGGTGCTGCTACAGGTGCAGCTGATTATAACGGTTACGGC
TATTATCCTTAACAACCTTCTTAAGATCCTTATTATTAATACTAATAATAGTATGCTGGC
TATGCTTCTACTTAAAATACACAATATTAATATCCCTATTCATATTCTTCTTCTTACTAT
TAAAACGGAGTTTATGGTACAGACCCTTCTTAAATGTATGGCCAACCTGCTTAGGCAAGC
AATATGCATGGATATCAATATCCCGCCACTGCTAGTACCTAAAATGCATAGGGATAAGCT
CAATAGTACTCATAACAATATCCATAGTAAGGTTAAGTTCCTCAAGTACCTACTGCAACT
ACAGCTACTAATCCTGCTGCTATTTAATAATAGTATTATAATTAAACTGCTTAAACTCCT
CAAGCTGCAAACAGCTAATAAGTAGCCTCTACTCATGATAAATATTCTTAAAATAATTAT
TAATCCCAATAATAATCTGCTAGCAATGCTCACTACTCTCAATAGTAATAGTATTCTCAT
TAATAGCAGTAATCTTAAGTTCAATCACAAGCATCCAGCCAATCATAAACTGCTCAACAA
CAATAGCTCTCAACTTAATAGTAATTGAACTAAACTGAAAAGAAGTCTGATGCTAACTCT
ATACCCACTCCCTCTGTTAAGGAATCATCTTTATTCCAAAAGCCTAGCTCTGATTTCATC
GGATATTAAACTGAATACGTAAGCATGACTGGCGAGCTTGAATTCATTTTGAAGCACAAC
ATATGCTGA


>TTHERM_00557810(protein)
MSNLDLRTLWVGDIENWMTEQFIESVFNKVGKVVSVKLIRTKETSLPAGYCFVEFQTHEQ
AERILMNYNQQLIPGTQNTFRMNWGKNPTNTGIIKQPTTQANNGYGNNQYGMMQQPVIQM
PPIQEFSIYVGELELGINEQQLAEHFRSKYSSVIGSKIITEPTSKMSKGYGFVKFSNPIE
GQRAIHEMNGSLFKGKFIKVSQAVSRQQQQAQAQAAGTPGFPQPAGYGAATGAADYNGYG
YYPQQPSQDPYYQYQQQYAGYASTQNTQYQYPYSYSSSYYQNGVYGTDPSQMYGQPAQAS
NMHGYQYPATASTQNAQGQAQQYSQQYPQQGQVPQVPTATTATNPAAIQQQYYNQTAQTP
QAANSQQVASTHDKYSQNNYQSQQQSASNAHYSQQQQYSHQQQQSQVQSQASSQSQTAQQ
QQLSTQQQLNQTEKKSDANSIPTPSVKESSLFQKPSSDFIGYQTEYVSMTGELEFILKHN
IC


>TTHERM_00557810(gene)
ATAATAAATAATTTCAAAAATAAATCTGTAAAGATAAAACCAATTAGTATTACTACTTTT
TAACAGAAATAGCTTTAAGGCATAAACTCATTAAAAGAGATAAATTACAATAAAAGATAA
GGTGTAGAAATGAGCAATTTAGATTTAAGAACATTGTGGGTTGGAGATATTGAAAACTGG
ATGACTGAATAATTTATTGAAAGTGTTTTTAATAAAGTTGGTAATAAATTAATTATTTAT
CAATAAGTTTAACTAAAAATATGATTTTTATTTTGAAATTTTATGATATGCAGCTTGAAA
TAAATTCTAATACATTATTTTTTATAACAATAGGTAAGGTTGTTAGCGTTAAGTTAATCA
GAACAAAAGAAACAAGTCTCCCTGCTGGTAATGAAAGCTTTATATTATCTGTCTTGAAGA
CTCTTAACATATTATTTATTTATATTATAAAGGTTATTGCTTCGTTGAATTTTAGACTCA
TGAACAAGCAGAAAGAATTTTGATGAATTACAACTAGTAGTTAATCCCTGGAACTCAAAA
TACCTTCAGAATGAATTGGGGAAAGAACCGTAAGATTCATTTATAAGCCAAAAACCTTAT
TTATCTTTTTTTATAATTAAATAGCTACTAACACTGGTATTATCAAGCAACCTACAACCT
AAGCTAATAATGGTTATGGAAATAATTAATATGGCATGATGCAATAGCCAGTGATCTAAA
TGCCACCTATTTAAGAATTCTCAGTAATTAAAATGATTATTTTAGAAAAACAATTTGCCT
ATTTTTAGAAACATTGTTAAAAATTGCTCTTAATTATGAATAAATAATTGATTGATTGAT
CATCCCACTTTAGAAAAAGACTTTTATTCTACAAAGTCAAAAATTATTTTAGCATATTTA
TCTTCTATGGAATACTAAGAAAAGTGATCTCATACGTAGTGTGCGAGTTAATAGATGAGA
AATTGGAATTGATATTTAAAATGATGAAAGTTGAAAAAAAGATATTAAACAAATAAATTT
ATCTAGACGACAGCTGTTATAAATAAGATTGATTATAAAAAAATTTAAAAGAAGATAAAT
AGAGAGCGAAAATATCTTATAATCAAATAAATTAAACTTGTATTTTTTGAAAAAGAAGAG
CATATATTATAAATAAGGAAATAATTAAATATCTTCGATAGCAAAAAAAAACAAACTTTG
TAATAGACTAAATTTTTACTCAAAATAAGTGTTTAAATTAAGTGGGAAAATTATCATATT
TCATTGGTTCATTCATTCATTTGTTTATCTTAAGGGCAATATTTAATAATCACTTGCAAA
ATAAATAAAACAGAAATTAACTTTTTTTTTTAAATATTTAGATTTATGTTGGTGAATTAG
AACTTGGCATTAACGAGTAACAACTTGCAGAGCACTTCAGATCTAAGTATTCTAGTGTAA
TTGGCTCTAAGATTATTACTGAACCTACCAGCAAGATGAGCAAAGGTTACGGCTTTGTAA
AGTTTTCTAATCCTATTGAAGGACAACGTGCTATTCATGAAATGAATGGCTCTCTTTTTA
AGGGCAAATTCATTAAGGTTTCTCAAGCTGTTTCAAGGTAATAATAACAGGCTTAAGCTT
AAGCTGCTGGAACACCTGGATTCCCTTAACCCGCAGGTTATGGTGCTGCTACAGGTGCAG
CTGATTATAACGGTTACGGCTATTATCCTTAACAACCTTCTTAAGATCCTTATTATTAAT
ACTAATAATAGTATGCTGGCTATGCTTCTACTTAAAATACACAATATTAATATCCCTATT
CATATTCTTCTTCTTACTATTAAAACGGAGTTTATGGTACAGACCCTTCTTAAATGTATG
GCCAACCTGCTTAGGCAAGCAATATGCATGGATATCAATATCCCGCCACTGCTAGTACCT
AAAATGCATAGGGATAAGCTCAATAGTACTCATAACAATATCCATAGTAAGGTTAAGTTC
CTCAAGTACCTACTGCAACTACAGCTACTAATCCTGCTGCTATTTAATAATAGTATTATA
ATTAAACTGCTTAAACTCCTCAAGCTGCAAACAGCTAATAAGTAGCCTCTACTCATGATA
AATATTCTTAAAATAATTATTAATCCCAATAATAATCTGCTAGCAATGCTCACTACTCTC
AATAGTAATAGTATTCTCATTAATAGCAGTAATCTTAAGTTCAATCACAAGCATCCAGCC
AATCATAAACTGCTCAACAACAATAGCTCTCAACTTAATAGTAATTGAACTAAACTGAAA
AGAAGTCTGATGCTAACTCTATACCCACTCCCTCTGTTAAGGAATCATCTTTATTCCAAA
AGGTAACTTTATTAATTTAAACTAATAAAATATGATATTTATTTTAGATCGATTTTAAAT
TTAAATAAACTCTTATTATTGATCGACAACAAATATTAAATAAATCAAATATTTAATAAA
AAAATAAATTAAATTTTAATAATATAAATAGCCTAGCTCTGATTTCATCGGATATTAAAC
TGAATACGTAAGCATGACTGGCGAGCTTGAATTCATTTTGAAGCACAACATATGCTGA