Identifiers and Description

Gene Model Identifier

TTHERM_00538800

Standard Name

RRM36 (RNA recognition motif-containing protein 36)

Aliases

PreTt12137 | 70.m00133 | 3728.m00032

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00538800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18193.19.997093137033517e-262hypothetical protein (1699 aa)
WormBaseWBGene000132705.000468829272308e-18status:Partially_confirmed U
niProt:Q9NA71 protein_id:CAB
55036.2
OxytrichaContig16750.0.g704.997543945741262e-17IBR domain
DictyBaseDDB_G02890430.00000000000003999587784428659DDB_G0289043 on chromosome: 5
position 2291494 to 2297048
SGDYKR017C0.0000000000009003435339752751YKR017C Putative protein of un
known function; contains a RIN
G finger motif

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00538800(coding)
ATGTAGCAGCTTTAATAGGAACTCTCTGAACTCATAAACTAATAGGGTTAAGTTCAAGAT
ATACACAGTACATTAACAAGAAACTCTGCTTCTAATAGTATTATAAGAGAAGAAACATTA
CAAAACTATTTGATTTCTGAAAGTAAAGAAAGCCAAGAAAATTTAAAGCATATTATCCAA
AAAAGCAAAATAGATTATTTGTGCAAATTGTAATCAACTTTCACTAGCTCTGAATAAGAA
CAAGAGTTGGCTGAATATATCAAAGATTTCAAAAATAATTTTGGATATCTTGGAAGCGAC
TAAAATAGCCATGTTTGGTAAATTTTATAAAGTTTGAACGAACTTTAATCTGTAAATAGT
GGATTATCATTTATAACAGATAAAAACCCTATTTAGAATGGAGGACTCATTTTTTCTCTT
TTAAAGAGTGCTTTTAATCTTTATCATAAAATTAACTTAGTTAACATATTCGAATCATAA
GCTAGTGAAGACAAGAACTTAAAGCTATAACTAGACGAATAGATGATAGAGACAATTTGG
GACTCCGTTATCGTAAATGGATCCAATAATAAAAAAACTGTTTACTTTTTAAATTTAGAG
TTTTTGAATCCTTCTTAGATTATTTTTATAGCAAAGTTATAGAAACATTTAAATAATTTA
AAAAATGAAGCTTAGATTCCAAATATCGTGATTTACTCTGATGACATTTTAGCATCATAG
CTTAAAGAGTAGATAAAGCCTTAATTAGAAATAGTTTTGGAGTTCAAAAGAATGCCTCAA
AAAATTTAGTATGTATAGAATGCTATTTTATCACAAAAAAGTAAAATGGATTTAATAGAG
CAACTGATAATTGATGCTTTGAAAAAATACAAGCAAACTTTGTTGAGATTTGACGTGCTT
ATATTTGTTAAGAACATTGAAGAGAGCAAATACTTATAGCAACACTATTTAAATCTTATC
AAAGAAAAACTAAATATTATAGATTTGACAGATATTGAAGTGAATGAAGAAGAAAGTAAG
TTTTACTTAGAAGATTTCAAAAAGAATTGGGAAAAATAATTGGTCGAAAAAAAAATAAAA
GAAAAAGAATTAAAAATTTAACAAGAAAAAGAATAGTAGGCCAAGAAAATTGAGGAGGAG
TTAGCACTTGAAAGAGAAAGACAAAGGAAGATTGAAGAAGATAAAAATAAAATATTCGAT
GAAGAAAAAAAACTAATAAAAGAAAAAATAAATCAATAACAAGTATAATAAATACCAGAT
GTTCATCCTTTACAACAAATTAATTAAGATGAACTTAACATTCCTCCTTTCCCTGCTGTT
CCAGAAATATAGCAATAATAGTTAAACTTATAAGAAATATAGATAAATTAAAATTAAGAG
TAAGAGATCTAATTATAGAAAGTACAAAGAGAAGAAGAGATGGTAAAAGAAGAAGAAGAG
TAAAAAAGAAAAGAAGAAGAACTAATGGTAAAAGAAGAAGAAGAGAGAAAAAGAATTGAA
GAAGAAGAAGTGAGAAAAATAAGAGAAGATGAAGAAAACATTAAATTAAAATAATTATAA
GAAGAAGAAGAGAGAAAAAGAAGAGAAGAAGAAGAAATTAAATTAAAAGAAGATGAAGAG
ATAAAAAGAAAGCAAGATGAAGAAAATAAGTTGAAGCAGGAAGAAGAAGAAAGATAAAAA
GATATACAGCAATATAATGAAGATTTAAATAAATAGATTAATAAAAATAAGTAAAATCTC
TACAAAGCAAATGAATTTAATATTTTCATAGCTAAAAGCTATAAGCAATTGAAACATCAT
AACTTAGATAATGTAATCATTTAAATTGATACAGGTGAAGCATTCAAAGTATATTTCATG
GATACTATTTTTGATTAGATTCCTGTAGTAAGCTCTAAAATTACAAGAGAAGAAGCTATT
AAAAGAGAAAGACTCATTGGTAATACTAAATCATGCGAAATTCATAGATTGTATGAAAAA
AAAGAATTCCTTAGACTACAAAAGAGGGATTTTTTGAATTTAATAAATTTGGAATAGTAT
AAGGCCTTTTCAGAAATTTAAAATGAGAAATGCCCTTAAAAGTAAGCAATTAGGATTTTG
TTATAGATCATGATAAATCTTAGTGAAAACTGGTTTAGCTGCTCTTCAGAAGTAGGAGCT
CATATCTCAATTTTATGGAGTAGAATGGGTGATATCTTTTCTGTTCATAACTAGCTCTTG
GTTTCTTAGACTGATGATTTATATTTAGCTTGCTAAAATCTCAATCTGCAGAATATTTTA
GAAAAAAATCAAGTTAATTCAAATCAATATGATAAAATTGTTTATAAAATGCTCAATATT
CAAAAAGTTTTAAATATCAAAGAAGATCCAGTTAAAATCTTACAGAAATTAGAAGCAACC
AAATTTTCAGAACTTGTTCAGTAAGTTGCTATAGAAAAATATTGGAAAAATTTATGCGTT
TATTCAGGACATAGAAGACTTGGTTTCCGTCACTTTGAATCAGCTAAAATGTTGAACTAT
GCTGAAATAAGCAGCATGAACCTTATTTAAGAAAGACCTTTCCTTATTATTCCCCTTCAG
CTTCAAATTAATTCTAAAAATTAATATGAAATAAAGCAATGCTTAGCTATAGATCATCCT
TTTTTACTAGAAAATGCTCCTTCTTAATTTATTGAAAAGCATTAACTCAGACTGCTTAAA
AGACAAAGTTTGAATTTGCATGAGATCGAATATTTTGGTATTTCAGATGCGTTGTTCTAA
TACTTTGAAGATAACAATTAAATAATTAAAGATATGGAAAATAAATTCGATTGTTATTAT
GAGCCTAATCATCATATGGACACTATAACCATACATTCTGATGCAAGCTAAAAGGAAAAA
CTAGAAAAACACTTTAATAACTTGCTTTAAGAAGCATAAAAAATACTCTCAGAAGAAGTT
ATGGAAATTTCACATGGAAACAACTGCATCCTAAAGATTTAAAAAGGAGGTACTATCAAA
GAAGTTACTATTTTACAGAATGAACACATCTTTATTGTTGATAATCTACCCTTAAATGTG
AAAGAGTAAGATGTTATAAATTTATTTGAAGAATATGGAGATATTGTTCAAGTCAAATTT
TTCACTGATCCCACCCTCAAAAATGTTGAAGAAAAATCTATTTCTGCAGAAGTTTTAGTG
GCTGAAACAGAAGATTCCAAATTTTTTGTAGAAACATTTAATTAAATAGAATTTTAAGAT
AGAGTCCTGCAGTTGCGTTTGAAAAACCACAGCTACTAAATACATCAAGATAATAATTCT
ACTAGATATCATAACATTTTTAGATGGCAAACTTGGAAATCAAAACAAACTGGAAGAATT
GAATTTCTTGATGAATCATCAGTTTAATCTTTTATGAAATTAGTTTAAAATAAACTAATT
GTTGATGGTAAGGAAATTAAAGCAGAATAGGATAAAAATTTTAATAAAACCGTCATATTG
AGTGGGCTATAAAAATGCACAGATGAAGAAACTTTAAAATCTTGTTTGATACCAGAACTT
TAAAAGAATATTGTGAGAATAAATGTAGATAGAATAGCTGATGTTGACAGAGGAATTAGC
AAAACTAGTTTAATATTCGCTCTTAATAAGATTTATAAAGAGTAACACTAAATAAGTTGG
GTAAGAAGAAAAGATCATGGTATTGTTGAAGCTAAAATATGCTTTTCTAAAAATTACTTA
TATAAGATGAACACTTACTATGAAAGATTTAATAGTAAGCCAGATATTTTAGGATAATAA
AAATTATATGTTTAAAGAAATTATATTGAAACCTTTAACTATGACTTGAAGATGATGAAC
GTAGTCTAAATGATATTAAAAGGTAATCAGGAATTAGTTTAAATGTAACAAAAGAATGAA
ATAAAACTCAAGGAAAAAATTGTAAGACCAATTCCCTCTAAATAAGAATTCATTGTAATT
TTGAAATGCAATGATGAAACCCACTTTAATAAGGCAAAAGGAATTATGTAAGCTCTGCTT
TAATCAAAACTGCTTGATTTGAGAAATGTAAAATTAGATTTGGCCAGCTTATTCGATGAG
GAAGATTAAGTAGATTACTCTTAGTTGTTCACTGAAATAGGATAAAAGAAGCTCAAAGAA
ATAGAAAGCAAATACCCAGTATTTTTCAAAATAAATTTAATCAAAGAAGAAGTTAGAGTT
TTCTGTACTGATGCCATTTATGATTTGATAAATAAAGATGTTGAGTACTTCTTAAGATAG
AGTGTCAGAGTTAAAATTCCTATTAGTGGAAAAAATATTAGAAACATACTTGGAATAGAT
GGAAGAGGTTTAGAAGAGTTTAAAAATAAAACTAACATTTGCAAAATTTAGCTAGACTAC
ATATCTAAAGACATTTATATGGAAGGTAATTCTAAGTAAGTTGACTAAGCTAAGAATGCT
TTACTTGCTTTATTGGAGGAAAAAAATAGCTAAGCATGCTTAAATAACATGCCTTATTCA
TATGAAGATTGCTAAGTCTGCTCTGACACTATTGTCACAGGATACAGATTGCAAGGCTGT
GGTCATAAATTTTGCCTAAGCTGTATTATGTTTGTAATAGATAATTCTTTAGGTGATGTG
AATTCTCTTCCAATTAAATGTCCTTTTTGCAGTTAAGCTATTATTATGAAAGATATAAAA
ACTCTTATGAGTGAGGATCAAATATAAAAAATGACAAGAATGTCTTTAAATCATTACATA
CAAAACAACTTTTAAGAATTCAGCTTTTGTGTGAATGAAAATTGTAAGTCTATTCATTCA
TCTAAACTAACTAAATATACTTGTTATGAATGCAAAAAAACTTACTGTTCAAAGTGTGCA
GCAGAATATCATTTTGGTATGACTTGTACAGTTTATTAGGAAACTGAAGCGAAAAACATA
GAATTCTTAATCAAAGAAGGTGCTCGTAAATGCCCTAATTGTGGAGTCTACATCATTCGT
ATAGATGGATGTTATAGGGTAGAATGTAGAAGATGCAACCAGCATATTTGCTGGAAAGAT
AATTGCATGAAGTTCTTTGCAACTTCATCCGAATGTTATAACCATTTAGACGAGAATCAT
GGAGGTTATTGGTGA


>TTHERM_00538800(protein)
MQQLQQELSELINQQGQVQDIHSTLTRNSASNSIIREETLQNYLISESKESQENLKHIIQ
KSKIDYLCKLQSTFTSSEQEQELAEYIKDFKNNFGYLGSDQNSHVWQILQSLNELQSVNS
GLSFITDKNPIQNGGLIFSLLKSAFNLYHKINLVNIFESQASEDKNLKLQLDEQMIETIW
DSVIVNGSNNKKTVYFLNLEFLNPSQIIFIAKLQKHLNNLKNEAQIPNIVIYSDDILASQ
LKEQIKPQLEIVLEFKRMPQKIQYVQNAILSQKSKMDLIEQLIIDALKKYKQTLLRFDVL
IFVKNIEESKYLQQHYLNLIKEKLNIIDLTDIEVNEEESKFYLEDFKKNWEKQLVEKKIK
EKELKIQQEKEQQAKKIEEELALERERQRKIEEDKNKIFDEEKKLIKEKINQQQVQQIPD
VHPLQQINQDELNIPPFPAVPEIQQQQLNLQEIQINQNQEQEIQLQKVQREEEMVKEEEE
QKRKEEELMVKEEEERKRIEEEEVRKIREDEENIKLKQLQEEEERKRREEEEIKLKEDEE
IKRKQDEENKLKQEEEERQKDIQQYNEDLNKQINKNKQNLYKANEFNIFIAKSYKQLKHH
NLDNVIIQIDTGEAFKVYFMDTIFDQIPVVSSKITREEAIKRERLIGNTKSCEIHRLYEK
KEFLRLQKRDFLNLINLEQYKAFSEIQNEKCPQKQAIRILLQIMINLSENWFSCSSEVGA
HISILWSRMGDIFSVHNQLLVSQTDDLYLACQNLNLQNILEKNQVNSNQYDKIVYKMLNI
QKVLNIKEDPVKILQKLEATKFSELVQQVAIEKYWKNLCVYSGHRRLGFRHFESAKMLNY
AEISSMNLIQERPFLIIPLQLQINSKNQYEIKQCLAIDHPFLLENAPSQFIEKHQLRLLK
RQSLNLHEIEYFGISDALFQYFEDNNQIIKDMENKFDCYYEPNHHMDTITIHSDASQKEK
LEKHFNNLLQEAQKILSEEVMEISHGNNCILKIQKGGTIKEVTILQNEHIFIVDNLPLNV
KEQDVINLFEEYGDIVQVKFFTDPTLKNVEEKSISAEVLVAETEDSKFFVETFNQIEFQD
RVLQLRLKNHSYQIHQDNNSTRYHNIFRWQTWKSKQTGRIEFLDESSVQSFMKLVQNKLI
VDGKEIKAEQDKNFNKTVILSGLQKCTDEETLKSCLIPELQKNIVRINVDRIADVDRGIS
KTSLIFALNKIYKEQHQISWVRRKDHGIVEAKICFSKNYLYKMNTYYERFNSKPDILGQQ
KLYVQRNYIETFNYDLKMMNVVQMILKGNQELVQMQQKNEIKLKEKIVRPIPSKQEFIVI
LKCNDETHFNKAKGIMQALLQSKLLDLRNVKLDLASLFDEEDQVDYSQLFTEIGQKKLKE
IESKYPVFFKINLIKEEVRVFCTDAIYDLINKDVEYFLRQSVRVKIPISGKNIRNILGID
GRGLEEFKNKTNICKIQLDYISKDIYMEGNSKQVDQAKNALLALLEEKNSQACLNNMPYS
YEDCQVCSDTIVTGYRLQGCGHKFCLSCIMFVIDNSLGDVNSLPIKCPFCSQAIIMKDIK
TLMSEDQIQKMTRMSLNHYIQNNFQEFSFCVNENCKSIHSSKLTKYTCYECKKTYCSKCA
AEYHFGMTCTVYQETEAKNIEFLIKEGARKCPNCGVYIIRIDGCYRVECRRCNQHICWKD
NCMKFFATSSECYNHLDENHGGYW


>TTHERM_00538800(gene)
ATGTAGCAGCTTTAATAGGAACTCTCTGAACTCATAAACTAATAGGGTTAAGTTCAAGAT
ATACACAGTACATTAACAAGAAACTCTGCTTCTAATAGTATTATAAGAGAAGAAACATTA
CAAAACTATTTGATTTCTGAAAGTAAAGAAAGCCAAGAAAATTTAAAGCATATTATCCAA
AAAAGCAAAATAGATTATTTGTGCAAATTGTAATCAACTTTCACTAGCTCTGAATAAGAA
CAAGAGTTGGCTGAATATATCAAAGATTTCAAAAATAATTTTGGATATCTTGGAAGCGAC
TAAAATAGCCATGTTTGGTAAATTTTATAAAGTTTGAACGAACTTTAATCTGTAAATAGT
GGATTATCATTTATAACAGATAAAAACCCTATTTAGAATGGAGGACTCATTTTTTCTCTT
TTAAAGAGTGCTTTTAATCTTTATCATAAAATTAACTTAGTTAACATATTCGAATCATAA
GCTAGTGAAGACAAGAACTTAAAGCTATAACTAGACGAATAGATGATAGAGACAATTTGG
GACTCCGTTATCGTAAATGGATCCAATAATAAAAAAACTGTTTACTTTTTAAATTTAGAG
TTTTTGAATCCTTCTTAGATTATTTTTATAGCAAAGTTATAGAAACATTTAAATAATTTA
AAAAATGAAGCTTAGATTCCAAATATCGTGATTTACTCTGATGACATTTTAGCATCATAG
CTTAAAGAGTAGATAAAGCCTTAATTAGAAATAGTTTTGGAGTTCAAAAGAATGCCTCAA
AAAATTTAGTATGTATAGAATGCTATTTTATCACAAAAAAGTAAAATGGATTTAATAGAG
CAACTGATAATTGATGCTTTGAAAAAATACAAGCAAACTTTGTTGAGATTTGACGTGCTT
ATATTTGTTAAGAACATTGAAGAGAGCAAATACTTATAGCAACACTATTTAAATCTTATC
AAAGAAAAACTAAATATTATAGATTTGACAGATATTGAAGTGAATGAAGAAGAAAGTAAG
TTTTACTTAGAAGATTTCAAAAAGAATTGGGAAAAATAATTGGTCGAAAAAAAAATAAAA
GAAAAAGAATTAAAAATTTAACAAGAAAAAGAATAGTAGGCCAAGAAAATTGAGGAGGAG
TTAGCACTTGAAAGAGAAAGACAAAGGAAGATTGAAGAAGATAAAAATAAAATATTCGAT
GAAGAAAAAAAACTAATAAAAGAAAAAATAAATCAATAACAAGTATAATAAATACCAGAT
GTTCATCCTTTACAACAAATTAATTAAGATGAACTTAACATTCCTCCTTTCCCTGCTGTT
CCAGAAATATAGCAATAATAGTTAAACTTATAAGAAATATAGATAAATTAAAATTAAGAG
TAAGAGATCTAATTATAGAAAGTACAAAGAGAAGAAGAGATGGTAAAAGAAGAAGAAGAG
TAAAAAAGAAAAGAAGAAGAACTAATGGTAAAAGAAGAAGAAGAGAGAAAAAGAATTGAA
GAAGAAGAAGTGAGAAAAATAAGAGAAGATGAAGAAAACATTAAATTAAAATAATTATAA
GAAGAAGAAGAGAGAAAAAGAAGAGAAGAAGAAGAAATTAAATTAAAAGAAGATGAAGAG
ATAAAAAGAAAGCAAGATGAAGAAAATAAGTTGAAGCAGGAAGAAGAAGAAAGATAAAAA
GATATACAGCAATATAATGAAGATTTAAATAAATAGATTAATAAAAATAAGTAAAATCTC
TACAAAGCAAATGAATTTAATATTTTCATAGCTAAAAGCTATAAGCAATTGAAACATCAT
AACTTAGATAATGTAATCATTTAAATTGATACAGGTGAAGCATTCAAAGTATATTTCATG
GATACTATTTTTGATTAGATTCCTGTAGTAAGCTCTAAAATTACAAGAGAAGAAGCTATT
AAAAGAGAAAGACTCATTGGTAATACTAAATCATGCGAAATTCATAGATTGTATGAAAAA
AAAGAATTCCTTAGACTACAAAAGAGGGATTTTTTGAATTTAATAAATTTGGAATAGTAT
AAGGCCTTTTCAGAAATTTAAAATGAGAAATGCCCTTAAAAGTAAGCAATTAGGATTTTG
TTATAGATCATGATAAATCTTAGTGAAAACTGGTTTAGCTGCTCTTCAGAAGTAGGAGCT
CATATCTCAATTTTATGGAGTAGAATGGGTGATATCTTTTCTGTTCATAACTAGCTCTTG
GTTTCTTAGACTGATGATTTATATTTAGCTTGCTAAAATCTCAATCTGCAGAATATTTTA
GAAAAAAATCAAGTTAATTCAAATCAATATGATAAAATTGTTTATAAAATGCTCAATATT
CAAAAAGTTTTAAATATCAAAGAAGATCCAGTTAAAATCTTACAGAAATTAGAAGCAACC
AAATTTTCAGAACTTGTTCAGTAAGTTGCTATAGAAAAATATTGGAAAAATTTATGCGTT
TATTCAGGACATAGAAGACTTGGTTTCCGTCACTTTGAATCAGCTAAAATGTTGAACTAT
GCTGAAATAAGCAGCATGAACCTTATTTAAGAAAGACCTTTCCTTATTATTCCCCTTCAG
CTTCAAATTAATTCTAAAAATTAATATGAAATAAAGCAATGCTTAGCTATAGATCATCCT
TTTTTACTAGAAAATGCTCCTTCTTAATTTATTGAAAAGCATTAACTCAGACTGCTTAAA
AGACAAAGTTTGAATTTGCATGAGATCGAATATTTTGGTATTTCAGATGCGTTGTTCTAA
TACTTTGAAGATAACAATTAAATAATTAAAGATATGGAAAATAAATTCGATTGTTATTAT
GAGCCTAATCATCATATGGACACTATAACCATACATTCTGATGCAAGCTAAAAGGTAATT
CTTAATTTTATTATTTCAATTATGAAAATAAAAATTTTTTTTTTTTTAATTTTCAACAGG
AAAAACTAGAAAAACACTTTAATAACTTGCTTTAAGAAGCATAAAAAATACTCTCAGAAG
AAGTTATGGAAATTTCACATGGAAACAACTGCATCCTAAAGATTTAAAAAGGAGGTACTA
TCAAAGAAGTTACTATTTTACAGAATGAACACATCTTTATTGTTGATAATCTACCCTTAA
ATGTGAAAGAGTAAGATGTTATAAATTTATTTGAAGAATATGGAGATATTGTTCAAGTCA
AATTTTTCACTGATCCCACCCTCAAAAATGTTGAAGAAAAATCTATTTCTGCAGAAGTTT
TAGTGGCTGAAACAGAAGATTCCAAATTTTTTGTAGAAACATTTAATTAAATAGAATTTT
AAGATAGAGTCCTGCAGTTGCGTTTGAAAAACCACAGCTACTAAATACATCAAGATAATA
ATTCTACTAGATATCATAACATTTTTAGATGGCAAACTTGGAAATCAAAACAAACTGTAA
TTTTATTCATCTTTCTTTGAATTTTTATTGAAAAATATTTTTTTAAATTAAGGGAAGAAT
TGAATTTCTTGATGAATCATCAGTTTAATCTTTTATGAAATTAGTTTAAAATAAACTAAT
TGTTGATGGTAAGGAAATTAAAGCAGAATAGGATAAAAATTTTAATAAAACCGTCATATT
GAGTGGGCTATAAAAATGCACAGATGAAGAAACTTTAAAATCTTGTTTGATACCAGAACT
TTAAAAGAATATTGTGAGAATAAATGTAAATTGATTATTAATTAATATATTTGTTTATTT
TACCATTTTATTTTTAATATAAAATAGGTAGATAGAATAGCTGATGTTGACAGAGGAATT
AGCAAAACTAGTTTAATATTCGCTCTTAATAAGATTTATAAAGAGTAACACTAAATAAGT
TGGGTAAGAAGAAAAGATCATGGTATTGTTGAAGCTAAAATATGCTTTTCTAAAAATTAC
TTATATAAGATGAACACTTACTATGAAAGATTTAATAGTAAGCCAGATATTTTAGGATAA
TAAAAATTATATGTTTAAAGAAATTATATTGAAACCTTTAACTATGACTTGAAGATGATG
AACGTAGTCTAAATGATATTAAAAGGTAATCAGGAATTAGTTTAAATGTAACAAAAGAAT
GAAATAAAACTCAAGGAAAAAATTGTAAGACCAATTCCCTCTAAATAAGAATTCATTGTA
ATTTTGAAATGCAATGATGAAACCCACTTTAATAAGGCAAAAGGAATTATGTAAGCTCTG
CTTTAATCAAAACTGCTTGATTTGAGAAATGTATTAAAATAATTAAATTTAAAATAATTT
TTATAGATTGATTAATTAATTGAAATAGGTAAAATTAGATTTGGCCAGCTTATTCGATGA
GGAAGATTAAGTAGATTACTCTTAGTTGTTCACTGAAATAGGATAAAAGAAGCTCAAAGA
AATAGAAAGCAAATACCCAGTATTTTTCAAAATAAATTTAATCAAAGAAGAAGTTAGAGT
TTTCTGTACTGATGCCATTTATGATTTGATAAATAAAGGTAAATTATTAATTAAGTTTAA
AACAAAATTAAGGAATTTATAAAATAATTAAAGATGTTGAGTACTTCTTAAGATAGAGTG
TCAGAGTTAAAATTCCTATTAGTGGAAAAAATATTAGAAACATACTTGGAATAGATGGAA
GAGGTTTAGAAGAGTTTAAAAATAAAACTAACATTTGCAAAATTTAGCTAGACTACATAT
CTAAAGACATTTATATGGAAGGTAATTCTAAGTAAGTTGACTAAGCTAAGAATGCTTTAC
TTGCTTTATTGGAGGAAAAAAATAGCTAAGCATGCTTAAATAACATGCCTTATTCATATG
AAGATTGCTAAGTCTGCTCTGACACTATTGTCACAGGATACAGATTGCAAGTAATTCAAA
GATATCAAATATTTTATTTTAACATTAATTGATATTTTTAAATAGAAATTGTCAAATAAA
ATATTTTAGAGCAAAATATTGATTTAATTTTTTAATTTATTAATTAGGGCTGTGGTCATA
AATTTTGCCTAAGCTGTATTATGTTTGTAATAGATAATTCTTTAGGTGATGTGAATTCTC
TTCCAATTAAATGTCCTTTTTGCAGTTAAGCTATTATTATGAAAGATATAAAAACTCTTA
TGAGTGAGGATCAAATATAAAAAATGACAAGAATGTCTTTAAATCATTACATACAAAACA
ACTTTTAAGAATTCAGCTTTTGTGTGAATGAAAATTGTAAGTCTATTCATTCATCTAAAC
TAACTAAATATACTTGTTATGAATGCAAAAAAACTTACTGTTCAAAGTGTGCAGCAGAAT
ATCATTTTGGTATGACTTGTACAGTTTATTAGGAAACTGAAGCGAAAAACATAGAATTCT
TAATCAAAGAAGGTGCTCGTAAATGCCCTAATTGTGGAGTCTACATCATTCGTATAGATG
GATGTTATAGGGTAGAATGTAGAAGATGCAACCAGCATATTTGCTGGAAAGATAATTGCA
TGAAGTTCTTTGCAACTTCATCCGAATGTTATAACCATTTAGACGAGAATCATGGAGGTT
ATTGGTGA