Identifiers and Description

Gene Model Identifier

TTHERM_00502180

Standard Name

RRM35 (RNA recognition motif-containing protein 35)

Aliases

PreTt08057 | 63.m00235 | 3716.m00087

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00502180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09613.12.0009580008310955e-119hypothetical protein (797 aa)
OxytrichaContig22254.0.g555.001052752541194e-37RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02750052.0006622580855403e-35DDB_G0275005 on chromosome: 2
position 4898014 to 4903137
SGDYER068W9.002954397174899e-30MOT2 Subunit of the CCR4-NOT c
omplex, which has roles in tra
nscription regulation, mRNA de
gradation, and post-transcript
ional modifications; with Ubc4
p, ubiquitinates nascent polyp
eptide-associated complex subu
nits and histone demethyase Jh
d2p
WormBaseWBGene000038279.997975313387782e-28locus:ntl-4 status:Partially
_confirmed protein_id:CDM634
96.1
Stentor CoeruleusSteCoe_352040.00000000003775134544279098

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00502180(coding)
ATGAGTGAAAGCGAAGATACAGTTATATGTAGTTATTTATACTTTTATTATTTGTTATAA
ACAGTTTAAAAAGGTAATCAATAGGTTGTTCAGCAATCTTAATAGGAGTAAATATCTTAT
AACAGCCCTCTGAAACTCAATTAAAAATAGGAAGATGATGATAAGTTATTTTATGCTAAT
AGCAATTCTTTGAACAATAAAAATCTACTAGCCAAAAAGAAAATGAGCTCAACTCAATAG
CATAAAAGACCCCACATAAATTCAAATATAGCTGATAGCTCTGATTAATTTGATTCGTAG
AATATGGATAATGCATGTTAAAATGTATCTAATAATAATTAAATACATAATGTTTCTCAT
CTCTCAAGAGTACGAGTTATCAAGAAAAATTTAGTATATGTCATAGGTATAGCTCCTTAA
TTAGCTAATGAGCAAATTTTGCAGTCTTACCAGTACTTTGGATAATATGGAAACATACAA
AAAATTGTTGTCAACAAAAACAACATATATAATCCTAAAGGACCTAATGGACCATCTTAT
AGCGCATACATAACATATACTGAAGAAAAAGAAGCATCTCTTTCTATACTTGGTGCAGAG
AACTTCAAAATTTTTGATAGAATAATTAGAGCCTCTTATGGAACAACGAAATATTGCAGC
TTCTTCCTGAAAAATTTAGATTGCCCTAATATACCAGATTGCCTTTACCTTCACTCATAC
GAAAAAGATGATGACTACTTCTCAAAAGATGAAATGGTCAGCAATAAAAATATATTCATC
GATCAACAGAAAATAGCTATTAAACATGTTAAAAAATATATACCAGAAATATTGAGTGAG
TATTAATAAAATAAAAGTTTTTATGAGTCTCAATCTCATATCTTTGCTCTACCAAATCTA
TCAAAAATAATAGATAAACTAAAAGAGTATTCCGCAATTACAAATGAGTAGTATTTAGCT
TGTAGAGAATATTAGCAAATCCCAAATACTTTTGTTTTGAGTTAGTTTTTGCCAAATGTA
ATAAATTAGCATGGATTAAATAACTCTTACAGCTCTTTTATAGCTTAAAACACTGTTGTA
CCATAATAACCGAAGTATGATTATGACTTTAAAGTACAATAAAGTTCATATTTTAATCCG
TTTTCTTAAAATCAAGAAAGTCTCACTACAACAACCTCTAGTTGCTTTAATAGATAACAA
TTTTATTATCAAAAAAAAAATAATTTCTTGTCTTAGAGTGCTATGAGTATAAATTAGGGT
ATTTATAGCAATGCTACTTAAAATTAATCACATTTTTCTTATTATTATCCTTCATCTCCT
CCTATTAAAACATAATATTTTACAGCACAATAATCTTAAAGCGAGTATTTAAACACAAAA
TATTGTTAATATGAATTAGTTAATCAAACCCCTTAAGTTACTCCATTTGAAATAAATGAT
CAATAAAGTAAATAAGATAGTGCTTAATAGAAAATTATCCAATAAAAATTTGATAATTTT
CCACATCCTCACCATAATAATTTTAATATTTATCAGCAAAATAACGATAATTTAAAATTT
GTTTAACCTAACGATGACAAGTCAAACTTTAGGCTCTAGTAAGACAATTCAAATATGAGT
AAATAAGAATTTTCAAAGCTTAATTACTCTTATGAAAAAGATAAAATAGCTGAGTTGACT
TCTGAAGACACAACTTAAGTTTCAATGGAATGCTCTCAAGCTGATAACAATTGTGCTTCT
CAAAATTAGGAAAAAAATTTTAAATCTGAAATTGAAAGCTATTCAAACAATTAGTATTCA
ACTTTAACTGAGACAAATAAGGAGTTAACAGACACTCAAAGCTAATATAGTATCGAAGAC
GATCTTAATGCTATTTAATCTGAAACTTTGTAGATTTAAAATAGTAAAGAAGATTATTTT
CACAAAATGCTTAATAAAAAAAAATCTTTGAACTAAATTTAAAGTCAAGTTGCTCACCTT
TCTAAAAAATCTAGTCACTCAATAAAATCCAATTACTCTTTAGGAGAATCAAATGAAGAA
GAAACAAATAAAATTTAAGAAATTTAACTAAATTAAAAATGTGAGTGTGACTCTTTACCA
GTTAAAGGAGAAGGAAACAGCATATCTTAAAATAAGTTTGATTCTGGAAGTAAGACAATA
AACCAAAATTACGAACTTATTGCTAATTTTTGGGATGAATAAAATTACAAAAATAAATAA
TAACAAATTCTTTTAAAACAGCAAAATAATTGCTTAGGATAAGAGTCTGAAAACGAAAAA
CATTAATTACTTGAGCAAAAAATAATACAAGATTAATAAAACTAAGAAAAAAATCCATTC
TATTATTATGAAAGCGAGTAAAATAGCTTTTAAGAGCTATGTTCTGGCTTTAATACGTTT
GTTTTAACTAAATTTTATTGA


>TTHERM_00502180(protein)
MSESEDTVICSYLYFYYLLQTVQKGNQQVVQQSQQEQISYNSPLKLNQKQEDDDKLFYAN
SNSLNNKNLLAKKKMSSTQQHKRPHINSNIADSSDQFDSQNMDNACQNVSNNNQIHNVSH
LSRVRVIKKNLVYVIGIAPQLANEQILQSYQYFGQYGNIQKIVVNKNNIYNPKGPNGPSY
SAYITYTEEKEASLSILGAENFKIFDRIIRASYGTTKYCSFFLKNLDCPNIPDCLYLHSY
EKDDDYFSKDEMVSNKNIFIDQQKIAIKHVKKYIPEILSEYQQNKSFYESQSHIFALPNL
SKIIDKLKEYSAITNEQYLACREYQQIPNTFVLSQFLPNVINQHGLNNSYSSFIAQNTVV
PQQPKYDYDFKVQQSSYFNPFSQNQESLTTTTSSCFNRQQFYYQKKNNFLSQSAMSINQG
IYSNATQNQSHFSYYYPSSPPIKTQYFTAQQSQSEYLNTKYCQYELVNQTPQVTPFEIND
QQSKQDSAQQKIIQQKFDNFPHPHHNNFNIYQQNNDNLKFVQPNDDKSNFRLQQDNSNMS
KQEFSKLNYSYEKDKIAELTSEDTTQVSMECSQADNNCASQNQEKNFKSEIESYSNNQYS
TLTETNKELTDTQSQYSIEDDLNAIQSETLQIQNSKEDYFHKMLNKKKSLNQIQSQVAHL
SKKSSHSIKSNYSLGESNEEETNKIQEIQLNQKCECDSLPVKGEGNSISQNKFDSGSKTI
NQNYELIANFWDEQNYKNKQQQILLKQQNNCLGQESENEKHQLLEQKIIQDQQNQEKNPF
YYYESEQNSFQELCSGFNTFVLTKFY


>TTHERM_00502180(gene)
ATGAGTGAAAGCGAAGATACAGTTATATGTAGTTATTTATACTTTTATTATTTGTTATAA
ACAGTTTAAAAAGGTAATCAATAGGTTGTTCAGCAATCTTAATAGGAGTAAATATCTTAT
AACAGCCCTCTGAAACTCAATTAAAAAGTAATTTTTTTAAACAATTTTATATTTGATTAG
TATATAATTATTAATAATTTTAGTAGGAAGATGATGATAAGTTATTTTATGCTAATAGCA
ATTCTTTGAACAATAAGTATTCGTATTTTTTGGTATTAATCACCCATATTCATTTACAAT
TATTTTTTAATAAACTTTAGAAATCTACTAGCCAAAAAGAAAATGAGCTCAACTCAATAG
CATAAAAGACCGTAATATAAATATATACCTATAAATTTAATTATTGTATTTAAATTTATT
TTTTTATTATTCAAAGCCACATAAATTCAAATATAGCTGATAGCTCTGATTAATTTGATT
CGTAGAATATGGATAATGCATGTTAAAATGTATCTAATAATAATTAAATACATAATGTTT
CTCATCTCTCAAGAGTACGAGTTATCAAGAAAAATTTAGTATATGTCATAGGTATAGCTC
CTTAATTAGCTAATGAGCAAGTAAAATAATTTGTTAATTCAAAGTTATTTGCAATAGTAA
TAAGCAATTAAAAATAATATTTAGATTTTGCAGTCTTACCAGTACTTTGGATAATATGGA
AACATACAAAAAATTGTTGTCAACAAAAACAACATATATAATCCTAAAGGACCTAATGGA
CCATCTTATAGCGCATACATAACATATACTGAAGAAAAAGAAGCATCTCTTTCTATACTT
GTATATATTATTTAATACAAAATAAATTTGTTTATAAAGTATCTATCTTGAAAAGGGTGC
AGAGAACTTCAAAATTTTTGATAGAATAATTAGAGCCTCTTATGGAACAACGAAATATTG
CAGCTTCTTCCTGAAAAATTTAGATTGCCCTAATATACCAGATTGCCTTTACCTTCACTC
ATACGAAAAAGATGATGACTACTTCTCAAAAGATGAAATGGTCAGCAATAAAAATATATT
CATCGATCAACAGAAAATAGCTATTAAACATGTTAAAAAATATATACCAGAAATATTGAG
TGAGTATTAATAAAATAAAAGTTTTTATGAGTCTCAATCTCATATCTTTGCTCTACCAAA
TCTATCAAAAATAATAGATAAACTAAAAGAGTATTCCGCAATTACAAATGAGTAGTATTT
AGCTTGTAGAGAATATTAGCAAATCCCAAATACTTTTGTTTTGAGTATTTTTTTTAATTA
ATTTTATTGGAAATTTTAATTATTTTTGGAAAATATAGGTTAGTTTTTGCCAAATGTAAT
AAATTAGCATGGATTAAATAACTCTTACAGCTCTTTTATAGCTTAAAACACTGTTGTACC
ATAATAACCGAAGTATGATTATGACTTTAAAGTACAATAAAGTTCATATTTTAATCCGTT
TTCTTAAAATCAAGAAAGTCTCACTACAACAACCTCTAGTTGCTTTAATAGATAACAATT
TTATTATCAAAAAAAAAATAATTTCTTGTCTTAGAGTGCTATGAGTATAAATTAGGGTAT
TTATAGCAATGCTACTTAAAATTAATCACATTTTTCTTATTATTATCCTTCATCTCCTCC
TATTAAAACATAATATTTTACAGCACAATAATCTTAAAGCGAGTATTTAAACACAAAATA
TTGTTAATATGAATTAGTTAATCAAACCCCTTAAGTTACTCCATTTGAAATAAATGATCA
ATAAAGTAAATAAGATAGTGCTTAATAGAAAATTATCCAATAAAAATTTGATAATTTTCC
ACATCCTCACCATAATAATTTTAATATTTATCAGCAAAATAACGATAATTTAAAATTTGT
TTAACCTAACGATGACAAGTCAAACTTTAGGCTCTAGTAAGACAATTCAAATATGAGTAA
ATAAGAATTTTCAAAGCTTAATTACTCTTATGAAAAAGATAAAATAGCTGAGTTGACTTC
TGAAGACACAACTTAAGTTTCAATGGAATGCTCTCAAGCTGATAACAATTGTGCTTCTCA
AAATTAGGAAAAAAATTTTAAATCTGAAATTGAAAGCTATTCAAACAATTAGTATTCAAC
TTTAACTGAGACAAATAAGGAGTTAACAGACACTCAAAGCTAATATAGTATCGAAGACGA
TCTTAATGCTATTTAATCTGAAACTTTGTAGATTTAAAATAGTAAAGAAGATTATTTTCA
CAAAATGCTTAATAAAAAAAAATCTTTGAACTAAATTTAAAGTCAAGTTGCTCACCTTTC
TAAAAAATCTAGTCACTCAATAAAATCCAATTACTCTTTAGGAGAATCAAATGAAGAAGA
AACAAATAAAATTTAAGAAATTTAACTAAATTAAAAATGTGAGTGTGACTCTTTACCAGT
TAAAGGAGAAGGAAACAGCATATCTTAAAATAAGTTTGATTCTGGAAGTAAGACAATAAA
CCAAAATTACGAACTTATTGCTAATTTTTGGGATGAATAAAATTACAAAAATAAATAATA
ACAAATTCTTTTAAAACAGCAAAATAATTGCTTAGGATAAGAGTCTGAAAACGAAAAACA
TTAATTACTTGAGCAAAAAATAATACAAGATTAATAAAACTAAGAAAAAAATCCATTCTA
TTATTATGAAAGCGAGTAAAATAGCTTTTAAGAGCTATGTTCTGGCTTTAATACGTTTGT
TTTAACTAAATTTTATTGA