Identifiers and Description

Gene Model Identifier

TTHERM_00497940

Standard Name

RRM34 (RNA recognition motif-containing protein 34)

Aliases

PreTt06959 | 62.m00243 | 3715.m00104

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08133 ) Anticodon nuclease activator family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00497940

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12679.15.002376098066827e-140hypothetical protein (570 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00497940(coding)
ATGAGCTCCTCTGATAATTCCCACTCTAAAAAGCCTTAAATTTTCATCAATCATGTTGAC
TTATCCATTACCGAAGAAGATATAAAAAAAGCCTGCGAAAATAAGGATACCAAACCAACC
AGCGTAACAATTCGCAAAAACCATGACTAAAAGAGCAATAATGTTAATATCACTTTTGCT
AACGAAAATGAAGCTAAAATCCTCAAGGGTAACGATAGCATATTAAAAGTTAATGATATT
ACTTTGAAATTAGAAGAATATCAAACTATTTATCCTCCTAATGTCTTTTTGAAGAATAAT
TATGGATTTACTGAAGAATAGATCCATGAAGGAATTAAAGCCATAATCAAGAACTACTTC
CACTTATCAGTTAGCAATCATTTAGTTAACATCTACGTGTAAGAAACTGATGATTTGAAT
CTTTTAATCAACCATGAACATAAAATCTAAGGAAAGGAAGTCCGTTTTGAAAAGTTCTAA
AAAAGCGTTAATAGCAAGTAAAGCAAGTAGAATTAGTTATACATAAAGTTCAGCACCAAT
TTAGGCACCAAAACTTAGGAAATATAAGATTTCATCAAAAACAAGTTCAATAACGAAGTT
ACCATTAGTTCCTTCAATTCTCTTGAAAAAAGTGCTAGTTAAAATTAATTAACCTACTTT
AGTGTAAACTTTAATGACGAATAGTAGGCTTAAGAGTATTACAATGAGTTGAAAGAAACA
TAAACAATTTTAAATCATAAAGTCAGCGTTTCTTGGAAAAGACCAGAAAATAGTGAAGAT
AGAACTTTGGTTTTAAAGTTTTTAAAAATGACTGTTTAGGAAGAAGAAGTTAAAAATGTG
TTTACTTAATTTGGTCATGTTCAATAATTAGAATTATTTAACGCTGCCTAAATTAAGGAT
AAGCCACTTACAAAAAGTGCTTATCTTTTGATGTCTAGTGAAGATGCTTGCAAACAAATT
ATGGCAGAAGCTCACAAGGACCCTAAAGTCAAATAGCTCTTCAATCAAGAAAAACCTTCA
ATTTCTCCTTAAATCGCTAAGACTGAGCTTATGACCTATAAAAATGCCATACATCCAAAT
GTTAACTATAACTAGAATATTTTCGTTCCTCCTTAATTCCCAATCCCTTAAAATTAACCT
ATGTATCCTAATAATCCTTACTTCTATATGCAATAACCTTAATTTTACTAAATTCCTTAT
TACAAGCAACAAACTCCTCATATGAACTAATAAGGAAGACACTTTAAATAAAACTATAAT
TAAAACAATAAAAGACCCAATCACTATCATGGAAACCCTGCAAACTAATAATATCATCAT
TAAAATTAAGTTTAAAATGGTGGTAATAATTACATGAAGAACTAAAACCAATAAGGTTAC
AGATAGTAATAATATTAACAACAACCTCATCCACAATAATAGCAATAATAACAGTAATAG
TAGTAATAATAATAAAAATAATATTAAATATAGACCAAAGAATAGTTAGAATAATAATTA
AAATAAAACCCTCAAAATTTCGATCAATTTATTAAATAATATACAAAATCATATATTGAA
GATAAATTAAGATCTGACTAGAAGCTATCTAACTTTATTAAATATGCTTTCCAAATAGCT
GAAATGATTACTGACAAAGAAAATTTCACCAATGATGAAATCATTGAAACAGTTACAAAT
GAAAAAGAAATCGTTGATAGAATTAATGAAGCTGTTGAGTTAATTTTAAAAAGTGCTTAA
ATCAAACAATGA


>TTHERM_00497940(protein)
MSSSDNSHSKKPQIFINHVDLSITEEDIKKACENKDTKPTSVTIRKNHDQKSNNVNITFA
NENEAKILKGNDSILKVNDITLKLEEYQTIYPPNVFLKNNYGFTEEQIHEGIKAIIKNYF
HLSVSNHLVNIYVQETDDLNLLINHEHKIQGKEVRFEKFQKSVNSKQSKQNQLYIKFSTN
LGTKTQEIQDFIKNKFNNEVTISSFNSLEKSASQNQLTYFSVNFNDEQQAQEYYNELKET
QTILNHKVSVSWKRPENSEDRTLVLKFLKMTVQEEEVKNVFTQFGHVQQLELFNAAQIKD
KPLTKSAYLLMSSEDACKQIMAEAHKDPKVKQLFNQEKPSISPQIAKTELMTYKNAIHPN
VNYNQNIFVPPQFPIPQNQPMYPNNPYFYMQQPQFYQIPYYKQQTPHMNQQGRHFKQNYN
QNNKRPNHYHGNPANQQYHHQNQVQNGGNNYMKNQNQQGYRQQQYQQQPHPQQQQQQQQQ
QQQQQKQYQIQTKEQLEQQLKQNPQNFDQFIKQYTKSYIEDKLRSDQKLSNFIKYAFQIA
EMITDKENFTNDEIIETVTNEKEIVDRINEAVELILKSAQIKQ


>TTHERM_00497940(gene)
TCTATCTGGAGATTTGATGAAATAAATGGGATAAAAAACAAAGATATATTAATTTGTCAA
TAAAGATAAAAATAATAGAAAGTTTTTGTATATAACTTAGGAAATAAGAAAAAATTAAAA
TATTAATCTTTAAAATTAAAAGAAAAAAAAAACCTACAATTAAAATAAAAAGCAAAAAGC
ATTTTAAAATTTCTATCTCAAAAATTCAAACAAATAAAAATGAGCTCCTCTGATAATTCC
CACTCTAAAAAGCCTTAAATTTTCATCAATCATGTTGACTTATCCATTACCGAAGAAGAT
ATAAAAAAAGCCTGCGAAAATAAGGATACCAAACCAACCAGCGTAACAATTCGCAAAAAC
CATGACTAAAAGAGCAATAATGTTAATATCACTTTTGCTAACGAAAATGAAGGTAAAATA
TTGCACTAATTAAAACTTTATAATTTTTAGTATAGTGAATTACTAACATTATTTATCTCC
ATGATTTTCCAGCTCTTTTACTTTCACCAAAGCTTTACAAAAGTATTGGAAGTTATTTAA
ATGATAAAAAGAGATTATTTAATAAAATGAGTTTTACTTTTATTAAAAGCATTCATTTAA
AAAAGATTACCAATTAAAGCAATTAAGTTAACATGTTTTACTTAGTTAAAAAGTTTTATG
ATATGCTTTATGAAATCTATTAGTTTTTTAATCGAAGGAGTGTATAATCAGGATAAATCA
ATTTACTAATTGATAATGCAAGAAACATAAATTAAAAATTTTTTTTTTTTAAAAGCTAAA
ATCCTCAAGGGTAACGATAGCATATTAAAAGTTAATGATATTACTTTGAAATTAGAAGAA
TATCAAACTATTTATCCTCCTAATGTCTTTTTGAAGAATAATTATGGATTTACTGAAGAA
TAGATCCATGAAGGAATTAAAGCCATAATCAAGAACTACTTCCACTTATCAGTTAGCAAT
CATTTAGTTAACATCTACGTGTAAGAAACTGATGATTTGAATCTTTTAATCAACCATGAA
CATAAAATCTAAGGAAAGGAAGTCCGTTTTGAAAAGTTCTAAAAAAGCGTTAATAGCAAG
TAAAGCAAGTAGAATTAGTTATACATAAAGTTCAGCACCAATTTAGGCACCAAAACTTAG
GAAATATAAGTAAGCAAATATATATTTTTTTTTAAACAAATAAAGAGAAATTTTCTATGA
AAAGGAAAAGTAGAAAATAAAAATATTTTATAAATTAGATAAAAAAAGCATTGCAATTAA
TTAAAATAAAGATATTAAAAATGCATTTATATTTATTTATAAAAATATTGAGTAAAAAAA
CTTTTTATAAAAAAGGATTTCATCAAAAACAAGTTCAATAACGAAGTTACCATTAGTTCC
TTCAATTCTCTTGAAAAAAGTGCTAGTTAAAATTAATTAACCTACTTTAGTGTAAACTTT
AATGACGAATAGTAGGCTTAAGAGTATTACAATGAGTTGAAAGAAACATAAACAATTTTA
AATCGTAAGAACATTCAATTAATTAATACTTTTTTTAATCAAAAATAGCTACCCACGTCT
TCTAAGAATATCTTAAATCCGCAATTTAATTGAATTGAATATCTTTTTAATTTAATTTTT
ATTAACTTATTTTTCTTAATTAAATCATTTTTGAAAAATAACTTTACAAATGTTATTAAA
AAGATAAAGTCAGCGTTTCTTGGAAAAGACCAGAAAATAGTGAAGATAGAACTTTGGTTT
TAAAGTTTTTAAAAATGACTGTTTAGGAAGAAGAAGTTAAAAATGTGTTTACTTAATTTG
GTCATGTTCAATAATTAGAATTATTTAACGCTGCCTAAATTAAGGATAAGCCACTTACAA
AAAGTGCTTATCTTTTGATGTCTAGTGAAGATGCTTGCAAACAAATTATGGCAGAAGCTC
ACAAGGACCCTAAAGTCAAATAGCTCTTCAATCAAGAAAAACCTTCAATTTCTCCTTAAA
TCGCTAAGACTGAGCTTATGACCTATAAAAATGCCATACATCCAAATGTAATTTTTTTTC
ACCACTTTATATTATTTTTTTTAATAATTTTGTCTAATTCAAAAAGGTTAACTATAACTA
GAATATTTTCGTTCCTCCTTAATTCCCAATCCCTTAAAATTAACCTATGTATCCTAATAA
TCCTTACTTCTATATGCAATAACCTTAATTTTACTAAATTCCTTATTACAAGCAACAAAC
TCCTCATATGAACTAATAAGGAAGACACTTTAAATAAAACTATAATTAAAACAATAAAAG
ACCCAATCACTATCATGGAAACCCTGCAAACTAATAATATCATCATTAAAATTAAGTTTA
AAATGGTGGTAATAATTACATGAAGAACTAAAACCAATAAGGTTACAGATAGTAATAATA
TTAACAACAACCTCATCCACAATAATAGCAATAATAACAGTAATAGTAGTAATAATAATA
AAAATAATATTAAATATAGACCAAAGAATAGTTAGAATAATAATTAAAATAAAACCCTCA
AAATTTCGATCAATTTATTAAATAATATACAAAATCATATATTGAAGATAAATTAAGATC
TGACTAGAAGCTATCTAACTTTATTAAATATGCTTTCCAAATAGCTGAAATGATTACTGA
CAAAGAAAATTTCACCAATGATGAAATCATTGAAACAGTTACAAATGAAAAAGAAATCGT
TGATAGAATTAATGAAGCTGTTGAGTTAATTTTAAAAAGTGCTTAAATCAAACAATGA