Identifiers and Description

Gene Model Identifier

TTHERM_00497860

Standard Name

RRM33 (RNA recognition motif-containing protein 33)

Aliases

PreTt06951 | 62.m00235 | 3715.m00096

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00497860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12685.19.997093137033517e-262RNA binding domain-containing
protein (817 aa)
DictyBaseDDB_G02817330.000000100009565553302DDB_G0281733 on chromosome: 3
position 4889095 to 4892360

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00497860(coding)
ATGTCAGATAGAAGAAAAGGTAAGAGATCTTACAGTCGCTCTAGATCAAGATCAAGATCT
AGATCCAGAAATAAAAAGCACTCTAAAAATAGCACGACAGACTATCACCGCAGCTCTTAA
AACAGCAGTAATACACATTCTAATAATGGAGGTGGAAGTAACAATAGTAGGAGAAATACA
GAAAGTTCAAGCTATCAATCAAGTAGCAAAAACAATAACTCTTCAAGTGGAAACTCTAGA
AACGATTCTAATTACTCTTCTAGTAATTATTAAGCAAGCAATTCAAGTAGTAGTATGAAT
AAAGATTCTAAGAGCTCAAAAGAAAGCAAAGATAGTAGAGATCATAGAGATAGCAAAGAT
AACAGAGATTACAGAGATAACAAAGATAGTAGAGATTTTAAAGACAATAGAGAAAAAGAT
CACAGAGATAGTAGAGATTACAAAGATCATAGAAGTAGAAAAGATTCAAGAGATAGGGAT
AGAGACAGAGAGAGAGAGAAAGAGAGAGAAAACAAGTCATCTTCAAACAAAGATGCAAAA
AAGCATTCATCATCATAGAATAAAAAGGAAAGCAGCTATTCAAGATCACGTTCACACTCT
CGCCATCGCTCTTCGAGATCATCATCTTCATCAGACGAAAAGAAAAAGTAGAAATCACTT
GAAAAACTACAAAGCAGCTCTCAGCAATGGAACTTTAAAGCAAAGTACGATGAATCTAAG
TGGTTGATGATTGAGAATATACCAGACACAATAGAAAAAAAGGATATTGAAGAGAAACTT
ACTCAAGTCAGTGCAGACTGTGGTACTTCTATTTATGATGATGTCAGATTAGTGTAGTAT
CTTGGGAGTGCTTACATTTAATATCCTTCAGTGAGTGCAGCTTCTAAGACCTTATATCAT
CTAAAAGGAAAGGTTAAACTAAGAGATTAATTCTATCCAATCGATTTTTACAATACCACA
TCAAGTTCTAATGGGAGTGGAAGTGGTGGAAATTAATCAAAAGCAGCTACTTTGTATGAC
AATATTTAAGCTGATTGGATTTGTGATAAATGTGATTACAAGAATTTTGCGAAGAGAGTT
AAATGCAATAAATGTGAAAAGCCACGTTCTTCTAGCTGTAGATTAATTATGAGTAGTGTT
AGTGGTGTCAAACCTTCCCTTGGATCTAGCTCTGGTGCTTAAGGTGAACTTACTACATCT
TTGATGATTAGAGGTAATGTAGTATCAACTATAAGTGAATCTCATTTAATAGATGCATTT
GAAAAATATGCTAAGATTAAGGATGTTAGACTAGTAAAAAATAAGCAAACTCTTTAATAA
AAAGATTTTGCTTTTGTTGAATTTTATACAATTGAAGATGCTGAAATGGTATTAGCATAA
ACAAATGTTCCTGAATTCAGAGTAGCTGGTGAGCCTGTAACAGTTTTGATTAGTAGAAAT
AAGAAGGCTGAAGATACAAGTGCATCTTATCCTATGGTAGCTGCAACTACTTATGATTAT
CACTAATAATAATATGGAGCTCAATATGATTATAGCTAATACTACTAATAAATGTATTCT
TAATATGGATAGTAACCAGCCTATATTGATTATGACGCAGTAGGGTACACAGCTTATGAT
TAATAGCAACAATAGCTTCAGTAAGTTTATTAATAATAATAAGAACAGATACTACCAGCT
TCACCATATAAGTAAGTATAACAATCATAATTATAAGCTTCCATACCTAACTAAATTCAG
TTAAATACTGTTTAGTAGTAATTGCCATAATAGCAAGTTGCACCTTAGATGTAATTTGAC
GTCACTTATGAAACTTTTGATTAGTCTGATTTGATAAAGTAAGCTCTTGAAAATGTTAAG
AATCACTCTCTATCTTTATAACAACAAAAAGAAGAAGAAAAATAGAAGCAAGAATCTTTA
AGAATTTAACAACATTAAGAAGAATAGAAAAAAAAGGAGTAAGCTGAAAAAAATATCTAA
GCATAAAAGACTATGGAGGATCAAATAAAACTTTTAGAAGAGTAGAAAAAGGCTTTGAAA
AAATCAGAAGATGAAAATAAAATGAAAGAAGTTCAAAATAAGATAAAAGAAAAGCAGGAT
GAGCAGTAAAGACAAAAGTAAAGATTAGAAAAATTAAAAGAAGTGTCATAAAAAGACGAG
GTGAGCATAGAAAAATAATAAGATTCTTAAAAGAGTGGTGAAGATAATAAAATGAATTTT
ATATAATTTGAAACAAATGCCTTTTCAACATCCTCTATGCCCTTAAAAACAATAGACATT
TAGCTAAATGGTTTAAACAGCTCATCTTAAAAATAAAAAGAAAAAATTTACATATGTTCG
ATTTGTAAAAGTAAGTTTGAATCAGAAAAGGCTGTAAATATTCACAACACTCATTCTAAA
TTGCACAAAGAAAATTTGAAACTTTATGGTTTAATTTGA


>TTHERM_00497860(protein)
MSDRRKGKRSYSRSRSRSRSRSRNKKHSKNSTTDYHRSSQNSSNTHSNNGGGSNNSRRNT
ESSSYQSSSKNNNSSSGNSRNDSNYSSSNYQASNSSSSMNKDSKSSKESKDSRDHRDSKD
NRDYRDNKDSRDFKDNREKDHRDSRDYKDHRSRKDSRDRDRDREREKERENKSSSNKDAK
KHSSSQNKKESSYSRSRSHSRHRSSRSSSSSDEKKKQKSLEKLQSSSQQWNFKAKYDESK
WLMIENIPDTIEKKDIEEKLTQVSADCGTSIYDDVRLVQYLGSAYIQYPSVSAASKTLYH
LKGKVKLRDQFYPIDFYNTTSSSNGSGSGGNQSKAATLYDNIQADWICDKCDYKNFAKRV
KCNKCEKPRSSSCRLIMSSVSGVKPSLGSSSGAQGELTTSLMIRGNVVSTISESHLIDAF
EKYAKIKDVRLVKNKQTLQQKDFAFVEFYTIEDAEMVLAQTNVPEFRVAGEPVTVLISRN
KKAEDTSASYPMVAATTYDYHQQQYGAQYDYSQYYQQMYSQYGQQPAYIDYDAVGYTAYD
QQQQQLQQVYQQQQEQILPASPYKQVQQSQLQASIPNQIQLNTVQQQLPQQQVAPQMQFD
VTYETFDQSDLIKQALENVKNHSLSLQQQKEEEKQKQESLRIQQHQEEQKKKEQAEKNIQ
AQKTMEDQIKLLEEQKKALKKSEDENKMKEVQNKIKEKQDEQQRQKQRLEKLKEVSQKDE
VSIEKQQDSQKSGEDNKMNFIQFETNAFSTSSMPLKTIDIQLNGLNSSSQKQKEKIYICS
ICKSKFESEKAVNIHNTHSKLHKENLKLYGLI


>TTHERM_00497860(gene)
GAGTTTTTATTTATTAGAAATTCTTTTTTATATTTAAAATAAAGAAATTTGATAAATTAA
TTTGTATAATTTTTTTTACTTTTAATGTCAGATAGAAGAAAAGGTAAGAGATCTTACAGT
CGCTCTAGATCAAGATCAAGATCTAGATCCAGAAATAAAAAGCACTCTAAAAATAGCACG
ACAGACTATCACCGCAGCTCTTAAAACAGCAGTAATACACATTCTAATAATGGAGGTGGA
AGTAACAATAGTAGGAGAAATACAGAAAGTTCAAGCTATCAATCAAGTAGCAAAAACAAT
AACTCTTCAAGTGGAAACTCTAGAAACGATTCTAATTACTCTTCTAGTAATTATTAAGCA
AGCAATTCAAGTAGTAGTATGAATAAAGATTCTAAGAGCTCAAAAGAAAGCAAAGATAGT
AGAGATCATAGAGATAGCAAAGATAACAGAGATTACAGAGATAACAAAGATAGTAGAGAT
TTTAAAGACAATAGAGAAAAAGATCACAGAGATAGTAGAGATTACAAAGATCATAGAAGT
AGAAAAGATTCAAGAGATAGGGATAGAGACAGAGAGAGAGAGAAAGAGAGAGAAAACAAG
TCATCTTCAAACAAAGATGCAAAAAAGCATTCATCATCATAGAATAAAAAGGAAAGCAGC
TATTCAAGATCACGTTCACACTCTCGCCATCGCTCTTCGAGATCATCATCTTCATCAGAC
GAAAAGAAAAAGTAGAAATCACTTGAAAAACTACAAAGCAGGTATAATTAAATGATTGAA
AAATCCCTCAGAAGATCATCAATCATAATTGTGCGAATCAACATATTATCTGATTTGCAA
TAATTGATGATTTAAGTGGTTTTTAGAAGATAAATGGGGAGATTTCTAGCAGTATTAACA
CTCTAATTAAGCATGTTAAATCGAAATAAATAATAGCTCTCAGCAATGGAACTTTAAAGC
AAAGTACGATGAATCTAAGTGGTTGATGATTGAGAATATACCAGACACAATAGAAAAAAA
GGATATTGAAGAGAAACTTACTCAAGTCAGTGCAGACTGTGGTACTTCTATTTATGATGA
TGTATGACTGCAATTAAATCTAAATAAAATATTTTTAATTTTTAAACCGAATATTTTGCA
ATAAAATAAAATTAAAATTATTTTTTTATTCAATTTATTTGTTTCATTTCAGATTTAGAT
AAAAACAAAATACTATTAATGAATGAATGAACGATTTAATTAACAACTCACTAATTTTAT
GTCTGCTGATAATATATTATTTATTAATTTTAATTAAGTCTATTTTAACTATAATTTTAA
TATGAATAGGTCAGATTAGTGTAGTATCTTGGGAGTGCTTACATTTAATATCCTTCAGTG
AGTGCAGCTTCTAAGACCTTATATCATCTAAAAGGAAAGGTTAAACTAAGAGATTAATTC
TATCCAATCGATTTTTACAATACCACATCAAGTTCTAATGGGAGTGGAAGTGGTGGAAAT
TAATCAAAAGCAGCTACTTTGTATGACAATATTTAAGCTGATTGGATTTGTGATAAATGT
GATTACAAGAATTTTGCGAAGAGAGTTAAATGCAATAAATGTGAAAAGCCACGTTCTTCT
AGCTGTAGATTAATTATGAGTAGTGTTAGTGGTGTCAAACCTTCCCTTGGATCTAGCTCT
GGTGCTTAAGGTGAACTTACTACATCTTTGATGATTAGAGGTAATGTAGTATCAACTATA
AGTGAATCTCATTTAATAGATGCATTTGAAGTAAAATATGTTTCTTTTTCCAAATAATTT
TTTTAAAAATTTTAATTATTTAAATTATTAAAAAAGAAATATGCTAAGATTAAGGATGTT
AGACTAGTAAAAAATAAGCAAACTCTTTAATAAAAAGATTTTGCTTTTGTTGAATTTTAT
ACAATTGAAGATGCTGAAATGGTATTAGCATAAACAAATGTTCCTGAATTCAGAGTAGCT
GGTGAGCCTGTAACAGTTTTGATTAGTAGAAATAAGAAGGCTGAAGATACAAGTGCATCT
TATCCTATGGTAGCTGCAACTACTTATGATTATCACTAATAATAATATGGAGCTCAATAT
GATTATAGCTAATACTACTAATAAATGTATTCTTAATATGGATAGTAACCAGCCTATATT
GATTATGACGCAGTAGGGTACACAGCTTATGATTAATAGCAACAATAGCTTCAGTAAGTT
TATTAATAATAATAAGAACAGATACTACCAGCTTCACCATATAAGTAAGTATAACAATCA
TAATTATAAGCTTCCATACCTAACTAAATTCAGTTAAATACTGTTTAGTAGTAATTGCCA
TAATAGCAAGTTGCACCTTAGATGTAATTTGACGTCACTTATGAAACTTTTGATTAGTCT
GATTTGATAAAGTAAGCTCTTGAAAATGTTAAGAATCACTCTCTATCTTTATAACAACAA
AAAGAAGAAGAAAAATAGAAGCAAGGTAGATTTTATAAAATAAAAATAAACAATAATTTT
TTTTTTTAAATATAGAATCTTTAAGAATTTAACAACATTAAGAAGAATAGAAAAAAAAGG
AGTAAGCTGAAAAAAATATCTAAGCATAAAAGACTATGGAGGATCAAATAAAACTTTTAG
AAGAGTAGAAAAAGGCTTTGAAAAAATCAGAAGATGAAAATAAAATGAAAGAAGTTCAAA
ATAAGATAAAAGAAAAGCAGGATGAGCAGTAAAGACAAAAGTAAAGATTAGAAAAATTAA
AAGAAGTGTCATAAAAAGACGAGGTGAGCATAGAAAAATAATAAGATTCTTAAAAGAGTG
GTGAAGATAATAAAATGAATTTTATATAATTTGAAACAAATGCCTTTTCAACATCCTCTA
TGCCCTTAAAAACAATAGACATTTAGCTAAATGGTTTAAACAGCTCATCTTAAAAATAAA
AAGAAAAAATTTACATATGTTCGATTTGTAAAAGTAAGTTTGAATCAGAAAAGGCTGTAA
ATATTCACAACACTCATTCTAAATTGCACAAAGAAAATTTGAAACTTTATGGTTTAATTT
GA