Identifiers and Description

Gene Model Identifier

TTHERM_00494500

Standard Name

RRM32 (RNA recognition motif-containing protein 32)

Aliases

PreTt04278 | 61.m00265 | 3711.m00112

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( TIGR00055 ) di-trans,poly-cis-decaprenylcistransferase
  • ( PF00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00494500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13043.19.997093137033517e-262hypothetical protein (364 aa)
OxytrichaContig11237.0.g249.995094197784295e-101RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000117222.000724368835138e-100status:Confirmed UniProt:Q22
412 protein_id:CAA93419.2
DictyBaseDDB_G02906493.999925618735366e-62DDB_G0290649 on chromosome: 5
position 4202596 to 4204042
SGDYBR065C1.9999391735788327e-19ECM2 Pre-mRNA splicing factor,
facilitates the cooperative f
ormation of U2/U6 helix II in
association with stem II in th
e spliceosome, function may be
regulated by Slu7p
Stentor CoeruleusSteCoe_157263.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00494500(coding)
ATGGCTACTGAAAGAGGTCTTTAGATTCGTACAGCAATTAACAAACAAGGTTGGGAAGAT
GCTGAGTTTCCCATATTATGTGAAACCTGCTTAGGAGATAATCCTTACGTTAGAATGATG
AAGGAAAAGCATGGTCAAGAATGTAAAATATGTACTAGACCTTTCACAGTTTTTAGATGG
AAAGCAGGTACTAAGGGAAGATTTAAAAAAACAGAAATATGTTAAACTTGTGCAAAACTT
AAAAACGTTTGTCAAACTTGCATTTTTGATTTACAATATGGTCTTCCAGTAGAAGTTCGT
GATAAATTTTTAGCAGAATAAGCAGTACATATGCCAACACAATAATCAAATAAAGATTAT
TTCACTCATTTAGCAAATAATAATTTGGACTAGCTTTCTCTACCATATGATTAAACTGTA
GGAAATACCATTCTTGAAAAAGTTGCAAGATTGAAGCCATATTATGAAAGAAATAAAGCT
AGAATTTGCAGTTTTTGGGTTAAGGGAAATTGTACTAGAGGTGATTTATGTCCTTACAGC
CACGAAAAAAGAGAAAATTAAGATGAAGATGATCCCTTAAATAAATAAAATCTCAAAGAT
AGATTCCATGGTAAAAATGACCCTCTTGCTTAAAAAGTCATGAATAAAATTTAGAATCAC
AAAGAAAACGATATAAAACCTCCTGCTGATCCAACAATAACTTCTTTATATATAGGAAAT
ATCACACCAGATTTCACAGAATAAGATTTCCATTAGATATTTGTCAAATACGGACCAATA
TAAAGCATTAAGATTATTTCTTAAAAAAGTTGTGCTTTTGTAAACTTCATAGCAAGAAAG
GCAGCAGAAGAAGCTATAAAAGACTTATATGGAAATTTTAATGTAAAAGGTATACAATTA
AGTATATCTTGGTCAAGAGCAGGTAAAAATTAATAGCAACAAAGTGAATTTTAAGGATAT
AATATTTAGCCTCCCTAAGAAAATCCTCCATAAAAGAGTTAAACAGAAAAGTAAATAAAT
AAACTTGGAGGAATAGTAAACTATAGTGATGATGAAGATAATGAAGATAACGAAGAATAA
GGCGGATAGAATTGA


>TTHERM_00494500(protein)
MATERGLQIRTAINKQGWEDAEFPILCETCLGDNPYVRMMKEKHGQECKICTRPFTVFRW
KAGTKGRFKKTEICQTCAKLKNVCQTCIFDLQYGLPVEVRDKFLAEQAVHMPTQQSNKDY
FTHLANNNLDQLSLPYDQTVGNTILEKVARLKPYYERNKARICSFWVKGNCTRGDLCPYS
HEKRENQDEDDPLNKQNLKDRFHGKNDPLAQKVMNKIQNHKENDIKPPADPTITSLYIGN
ITPDFTEQDFHQIFVKYGPIQSIKIISQKSCAFVNFIARKAAEEAIKDLYGNFNVKGIQL
SISWSRAGKNQQQQSEFQGYNIQPPQENPPQKSQTEKQINKLGGIVNYSDDEDNEDNEEQ
GGQN


>TTHERM_00494500(gene)
ATGGCTACTGAAAGAGGTCTTTAGATTCGTACAGCAATTAACAAACAAGGTATTAACAAA
TTCTTTTTGATTTGTTTGCTCATATTTAATAGAATCCTTATTAACTACTTAATTGATCAA
TATTAATTAATGATATTTATTTCAGCATTTAAAAATAAAATTAGGTTGGGAAGATGCTGA
GTTTCCCATATTATGTGAAACCTGCTTAGGAGATAATCCTTACGTTAGAATGGTATGAAG
AAATATTTTAATACTTATTTATAGATCGGCTAATAACCATATTTTTAATTACTTAAATAG
ATGAAGGAAAAGCATGGTCAAGAATGTAAAATATGTACTAGACCTTTCACAGTTTTTAGA
TGGAAAGCAGGTACTAAGGGAAGATTTAAAAAAACAGAAATATGTTAAACTTGTGCAAAA
CTTAAAAACGTTTGTCAAACTTGCATTTTTGATTTACAATATGGTCTTCCAGTAGAAGTT
CGTGATAAATTTTTAGCAGAATAAGCAGTACATATGCCAACACAATAATCAAATAAAGAT
TATTTCACTCATTTAGCAAATAATAATGTAACGCAATTTATTTTTTTAACGACTCAATTA
ATTCTTTATTTTACTGTAAAGTTGGACTAGCTTTCTCTACCATATGATTAAACTGTAGGA
AATACCATTCTTGAAAAAGTTGCAAGATTGAAGCCATATTATGAAAGAAATAAAGCTAGA
ATTTGCAGTTTTTGGGTTAAGGGAAATTGTACTAGAGGTGATTTATGTCCTTACAGCCAC
GAAAAAAGAGAAAATTAAGATGAAGATGATCCCTTAAATAAATAAAATCTCAAAGATAGA
TTCCATGGTAAAAATGACCCTCTTGCTTAAAAAGTCATGAATAAAATTTAGAATCACAAA
GAAAACGATATAAAACCTCCTGCTGATCCAACAATAACTTCTTTATATATAGGAAATATC
ACACCAGATTTCACAGAATAAGATTTCCAGTAAGATTTTTAAAATAAATAAAAATAAATT
TTTAAGTTTTTTTATAAATAAAATAGTTAGATATTTGTCAAATACGGACCAATATAAAGC
ATTAAGATTATTTCTTAAAAAAGTTGTGCTTTTGTAAACTTCATAGCAAGAAAGGCAGCA
GAAGAAGCTATAAAAGACTTATATGGAAATTTTAATGTAAAAGGTATACAATTAAGTATA
TCTTGGTCAAGAGCAGGTAAAAATTAATAGCAACAAAGTGAATTTTAAGGATATAATATT
TAGCCTCCCTAAGAAAATCCTCCATAAAAGAGTTAAACAGAAAAGTAAATAAATAAACTT
GGAGGAATAGTAAACTATAGTGATGATGAAGATAATGAAGATAACGAAGAATAAGGCGGA
TAGAATTGA