Identifiers and Description

Gene Model Identifier

TTHERM_00490750

Standard Name

RRM31 (RNA recognition motif-containing protein 31)

Aliases

PreTt08380 | 60.m00177

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00498 ) FHA domain
  • ( TIGR02464 ) conserved hypothetical protein
  • ( PF08719 ) Domain of unknown function (DUF1768)
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.7%

TetraMine Data

TTHERM_00490750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13542.19.997093137033517e-262FHA domain-containing protein
(790 aa)
OxytrichaContig3470.0.g1015.001742359316081e-68RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
Stentor CoeruleusSteCoe_20471.9287498479639178e-22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00490750(coding)
ATGAGTGACGATATAAATAATAAATTGGTTAACTATTTAATTCATAAACCAAAAGATTAA
GTTATAGATAAGTTTGAAGAATATTTTAGCTTTCTCAATAATGACGAGCCTTCATGGATT
TTATACGAAGGTATTTTATATCCTTCAGTAAGTGTAGCATTTTAAGGGGCAAGAGCTTAG
GATTTTGAGATAAAGTAGAAAATAGCAGATGTAGATTCTCCTGATGATCTCATATTACTA
GCTTCTGAAATCGAAGATCCTCCTGATTGGGAGAATAGAAGATTAAAAGTCATGGAAATT
CTAATTAGAGATAAATTTCGTCGTTCTCTTGAATTGAGAGAGAGATTAAGACTAACTGAA
GAAAAGTAGCTAGTTTGCAGATTTTTCGAAGAATCACCTAGTAATTTGTTTTGGGGTATA
GTTGGAAGCAAAGGATAAAATTAGATAGGAAGAATTTTAGAAAAGGTTAGAGGAGATATT
CATTAAAATGTTGATTTGAAAAAGTGGATGTAAACTAAATTTCCTTTGCAATAGGACAAG
ATTTTGTTACCAGTAATCACTTTGAATGTTTCAAAAGATGGAGAATAGATTGAAACTATA
ACATTAAAAGAAAGAAGTTATTATTATATGGGCTAATATAAAACAAATAGCGTTATCCTG
GCTCATCCAAGTATTTCTCGTTTACACGCTTGTTTGATCTGTGAGGAAGGTAATAAAGTT
AGACTTGTTGATATGGAATCTAAATCAGGTTCTTTTGTTAATGGGGAGATATTAGAGAAG
CTTTTTGATAAAGAATTGCAGACAGGAGATATTTTGACTTTTGCTTTATCTACTCGCTCT
TATGAGATTAATATTGATTATACTGCAGCTAAGTAAGAGTTGCAAAAAAGAAGCATTCAA
TTACAACAGTAAGTTAAGCAACTTTAGAAATTGAACTAACCTTCGATTACTCCTGAAGAA
CTTCGTAGAATTATGGGATTTGATATTGATAATACTTTATTTATCAGTGGATTACCTGAT
AATGCTACTGTTTTAGGTATTAGAGAAATGTTTGAGAGAATAAGTGAACCTAAAAACAAG
GATGAAAATGAAAAGAAAAAATTTTAAGGAATTAAAATCAAAGTTTAAGAAGTAAAAATT
CCTGTTGACAAGTGGTCAGGAAGACCAAAAGGCTTTGCTTATGTTACATTTTAGACCAGG
GAAGATTTTAATAATGCACAATTGTACTCCTTTGGTTTGAAGTATGGGGAAGTAAAGCTT
AAAGTTAAGGTGGCAGATAAGGATAAATCTGCTTAATTAATGAATATTTGCAAGATTAAA
GATGGAAATAATAACGATGAAGACTCTAAAAAAAGATACGATGATAAAAGAGGCAGTGAA
AGAAGTAGAAGAGAAAGAAGTTCTGATAGACATAGGGATAGAAGCTCTGAGAGATATAGA
GATAGAGACTCAAAATATAAAAGAAGATACAGCAAATCTAGATCAAGATCAAACGATAGA
AAACTTAGAGATAAGAATAGAGTTAGTAAGTTTGATAATAATAACCAAGACAAAGAACAA
AAAAGAGAAAGAGAAGAGGTTAAAAATGAATAGAATTAGGATTTGGAAAAAAAGCAAAAT
AGTGAAGACGCTTAGAAAAAAGAAGAAAAAGAGCCATCAAGCAAAGTTAAGGAAAACAAA
GATAAAAGAAAAAGAAGCGACAGTAGAGATAATAACAAAAAGTAAGACAAAAGAAGAGAT
AGATCTGAGTCAAAGAGCAAAAATTAAAAATCATCTTCTCGTCATGAAAAACACAAGAGA
AGAAGTTAATCTCCTAAATAAAAGAGAGGTAGCTCTTAAACAAAAAATGAATCAAAAAAA
TCTACTAAACATTCTAGAAGCAGATCAAGAGAAAGAGAAAGAGATAGGGAAAGAGATAGA
GATAGAAAAGATAACAGAAAGAGTAATAAAGATAGCAGAAAATCAACTTCAAGAGATAAA
AAATAACATAGAAAGAGCTCATCTAAAGATAGAAAAAAACAAGATGAATAAAATAATAAG
TCAAACAAAGCCTCAGAGTTACCAAAGAAAAGTGATAAATAAGCTGATAAAGATTCAAAG
GCTAAAACTGATAAACAATTAGCAGAAAAACAAAGCGAAAACTAAGTCAGTAAAAGAGAA
GAGAAAGAAACAAACCAAAAAGCTAAATAAACTAAAGAAAAAAAGAGAAAAGAAAGTGTA
TCTTCAAATTCATCTTCATCTTAATCTTCAAGATCTTCATCTTCTTCAAATTCATCTAAT
TCAAGATCATCTTCTTTTTCTTCTTCTTCATCTTCTCAAAGCAGTAGTTGA


>TTHERM_00490750(protein)
MSDDINNKLVNYLIHKPKDQVIDKFEEYFSFLNNDEPSWILYEGILYPSVSVAFQGARAQ
DFEIKQKIADVDSPDDLILLASEIEDPPDWENRRLKVMEILIRDKFRRSLELRERLRLTE
EKQLVCRFFEESPSNLFWGIVGSKGQNQIGRILEKVRGDIHQNVDLKKWMQTKFPLQQDK
ILLPVITLNVSKDGEQIETITLKERSYYYMGQYKTNSVILAHPSISRLHACLICEEGNKV
RLVDMESKSGSFVNGEILEKLFDKELQTGDILTFALSTRSYEINIDYTAAKQELQKRSIQ
LQQQVKQLQKLNQPSITPEELRRIMGFDIDNTLFISGLPDNATVLGIREMFERISEPKNK
DENEKKKFQGIKIKVQEVKIPVDKWSGRPKGFAYVTFQTREDFNNAQLYSFGLKYGEVKL
KVKVADKDKSAQLMNICKIKDGNNNDEDSKKRYDDKRGSERSRRERSSDRHRDRSSERYR
DRDSKYKRRYSKSRSRSNDRKLRDKNRVSKFDNNNQDKEQKREREEVKNEQNQDLEKKQN
SEDAQKKEEKEPSSKVKENKDKRKRSDSRDNNKKQDKRRDRSESKSKNQKSSSRHEKHKR
RSQSPKQKRGSSQTKNESKKSTKHSRSRSRERERDRERDRDRKDNRKSNKDSRKSTSRDK
KQHRKSSSKDRKKQDEQNNKSNKASELPKKSDKQADKDSKAKTDKQLAEKQSENQVSKRE
EKETNQKAKQTKEKKRKESVSSNSSSSQSSRSSSSSNSSNSRSSSFSSSSSSQSSS


>TTHERM_00490750(gene)
ATGAGTGACGATATAAATAATAAATTGGTTAACTATTTAATTCATAAACCAAAAGATTAA
GTTATAGATAAGTTTGAAGAATATTTTAGCTTTCTCAATAATGACGAGCCTTCATGGATT
TTATACGAAGGTATTTTATATCCTTCAGTAAGTGTAGCATTTTAAGGGGCAAGAGCTTAG
GATTTTGAGATAAAGTAGAAAATAGCAGATGTAGATTCTCCTGATGATCTCATATTACTA
GCTTCTGAAATCGAAGATCCTCCTGATTGGGAGAATAGAAGATTAAAAGTCATGGAAATT
CTAATTAGAGATAAATTTCGTCGTTCTCTTGAATTGAGAGAGAGATTAAGACTAACTGAA
GAAAAGTAATATTTTTTATTTACTATTTATCTGTCGATTAGTTAATAAATCATATAGACC
ATATATTTTAGTTTGTTTTGAGGATTTTAAAAAATAAAAATGTTAAAAAATAGGCTAATT
TAAATAGACCACGAATTTGGAAAATAAAACAGAAAGATTTGTTTCATTTTATTGATAATT
TGTTTGTTTTTTATTTATAAAGGTAGCTAGTTTGCAGATTTTTCGAAGAATCACCTAGTA
ATTTGTTTTGGGGTATAGTTGGAAGCAAAGGATAAAATTAGATAGGAAGAATTTTAGAAA
AGGTTAGAGGAGATATTCATTAAAATGTTGATTTGAAAAAGTGGATGTAAACTAAATTTC
CTTTGCAATAGGACAAGATTTTGTTACCAGTAATCACTTTGAATGTTTCAAAAGATGGAG
AATAGATTGAAACTATAACATTAAAAGAAAGAAGTTATTATTATATGGGCTAATATAAAA
CAAATAGCGTTATCCTGGCTCATCCAAGTATTTCTCGTTTACACGCTTGTTTGATCTGTG
AGGAAGGTAATAAAGTTAGACTTGTTGATATGGAATCTAAATCAGGTTCTTTTGTTAATG
GGGAGATATTAGAGAAGCTTTTTGATAAAGAATTGCAGACAGGAGATATTTTGACTTTTG
CTTTATCTACTCGCTCTTATGAGATTAATATTGATTATACTGCAGCTAAGTAAGAGTTGC
AAAAAAGAAGCATTCAATTACAACAGTAAGTTAAGCAACTTTAGAAATTGAACTAACCTT
CGATTACTCCTGAAGAACTTCGTAGAATTATGGGATTTGATATTGATAATACTTTATTTA
TCAGTGGATTACCTGATAATGCTACTGTTTTAGGTATTAGAGAAATGTTTGAGAGAATAA
GTGAACCTAAAAACAAGGATGAAAATGAAAAGAAAAAATTTTAAGGAATTAAAATCAAAG
TTTAAGAAGTAAAAATTCCTGTTGACAAGTGGTCAGGAAGACCAAAAGGCTTTGCTTATG
TTACATTTTAGACCAGGGAAGATTTTAATAATGCACAATTGTACTCCTTTGGTTTGAAGT
ATGGGGAAGTAAAGCTTAAAGTTAAGGTGGCAGATAAGGATAAATCTGCTTAATTAATGA
ATATTTGCAAGATTAAAGATGGAAATAATAACGATGAAGACTCTAAAAAAAGATACGATG
ATAAAAGAGGCAGTGAAAGAAGTAGAAGAGAAAGAAGTTCTGATAGACATAGGGATAGAA
GCTCTGAGAGATATAGAGATAGAGACTCAAAATATAAAAGAAGATACAGCAAATCTAGAT
CAAGATCAAACGATAGAAAACTTAGAGATAAGAATAGAGTTAGTAAGTTTGATAATAATA
ACCAAGACAAAGAACAAAAAAGAGAAAGAGAAGAGGTTAAAAATGAATAGAATTAGGATT
TGGAAAAAAAGCAAAATAGTGAAGACGCTTAGAAAAAAGAAGAAAAAGAGCCATCAAGCA
AAGTTAAGGAAAACAAAGATAAAAGAAAAAGAAGCGACAGTAGAGATAATAACAAAAAGT
AAGACAAAAGAAGAGATAGATCTGAGTCAAAGAGCAAAAATTAAAAATCATCTTCTCGTC
ATGAAAAACACAAGAGAAGAAGTTAATCTCCTAAATAAAAGAGAGGTAGCTCTTAAACAA
AAAATGAATCAAAAAAATCTACTAAACATTCTAGAAGCAGATCAAGAGAAAGAGAAAGAG
ATAGGGAAAGAGATAGAGATAGAAAAGATAACAGAAAGAGTAATAAAGATAGCAGAAAAT
CAACTTCAAGAGATAAAAAATAACATAGAAAGAGCTCATCTAAAGATAGAAAAAAACAAG
ATGAATAAAATAATAAGTCAAACAAAGCCTCAGAGTTACCAAAGAAAAGTGATAAATAAG
CTGATAAAGATTCAAAGGCTAAAACTGATAAACAATTAGCAGAAAAACAAAGCGAAAACT
AAGTCAGTAAAAGAGAAGAGAAAGAAACAAACCAAAAAGCTAAATAAACTAAAGAAAAAA
AGAGAAAAGAAAGTGTATCTTCAAATTCATCTTCATCTTAATCTTCAAGATCTTCATCTT
CTTCAAATTCATCTAATTCAAGATCATCTTCTTTTTCTTCTTCTTCATCTTCTCAAAGCA
GTAGTTGA