Identifiers and Description

Gene Model Identifier

TTHERM_000486877

Standard Name

RRM30 (RNA recognition motif protein)

Aliases

None

Description

RNA recognition motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_000486877

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12183.11.0001267035975107e-72hypothetical protein (438 aa)
OxytrichaContig7157.0.g230.0000007997233352734267RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02828730.0000009995106777214876DDB_G0282873 on chromosome: 3
position 6325570 to 6328516
SGDYNL175C0.00003998524687536623NOP13 Nucleolar protein found
in preribosomal complexes; con
tains an RNA recognition motif
(RRM)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000486877(coding)
ATGTTTACAAGTGTTAGAAAAAATAAAATAAAACCAGTATTGGGATCTGACAGAACCGAA
AAAAGCAAAACTGATTACAAAGAATCTATCGAAGAAGAAGATATTGAATTAGATATTGGA
GAAGACTTAGTTGATGATGATAAAGATGAAAAAGTTTAGTTATAGGAAAGATCTGATAAA
TAAAACAATCAGCAATAAGAAAACAATCCATCTAAGGAAAATAATAATAATGAAAGTGAT
ATTGAAGAAAAAGTAGTAGGAGGTGATTATGAAGAGCCAGAATTTTTAGGTGAAGAAGAA
GCGGAAGGTGAAAACGATGATAAAAAATATGATTGGATGGATTCCGATGACGAGGAAGAT
GGAGATGATTAAAAAAATGACCATGATAAAAACGATAGCAATAGCTCTCCTAATTAAAGG
AACAGAAAAAGCTAGAACAATATGTAAATTCCTTTAAACAAAGAAGAACCTGAGTAGAGA
ACCATAGTTGTGACAAACTTAAATTTTGAGCTTTCAGATAAAGAAATAAGAAATTACTTC
TAACAATTCGGTAACATTGAAGATTTAATTGTACCCAGAAATGAAGGATAACTATTTAAC
AAAGGAAGAGCGTTTGTTTAATATTCTACAGTTGCTATGGCGTAATTGGCAGCTTAAAAA
AATGGTGAATTGTTCAAAGGCCGTCCACTTGAAATCAACTTGGGTCTTTAATCAGGAGTG
AATATGAACAAAAAAGTACCTTTCATGTAAAATAAGGGCAGCAAGCACTAATCAAAGCTA
CTAAAATCAAGAAGTAAAAGTAGGGAAAAGAAAAGTAGTAGAAGTAAGAGTAATGAAGAC
AGCTATAGTAGAAGCAGAAGTAGAAGTAGAAGTAGTTCTAGCAAACGTAGTAGCAGCAGA
AGTAGCAGTAGAAGTCGTAGTAGTAACAGCGGTAGCTAGAGCTAAAGTCGTAGTAGGAGT
AATAGTTAAGGAGAAGATAAAAAAAGTTCTTCAAGAAGAGATTCGACTTAGCATAATCGT
CATAGGGATCGCTATAGAAACTAAGATAGAAGAAAAAACGATAGCCGCAGTAGATCTAGA
AGCTAAGAAAGAAGAAACTCTTAGCACAGTCGTGATAATAACAGGCATTATAATCGTCAC
TAGCATGGCCGTCAATAATACTAAAACAAAAACTATTAAAGTTAAGGGTAGAGAGGTGGT
TAAGGCCAAAATAGAAGCAATTATAACAACAATAACGGTAACCGCAATTATGGAGGTGGA
TAAAGGCACGGAGGTTAAGGATCACACTATGGTGGCAGTGGACACAGAAATTGA


>TTHERM_000486877(protein)
MFTSVRKNKIKPVLGSDRTEKSKTDYKESIEEEDIELDIGEDLVDDDKDEKVQLQERSDK
QNNQQQENNPSKENNNNESDIEEKVVGGDYEEPEFLGEEEAEGENDDKKYDWMDSDDEED
GDDQKNDHDKNDSNSSPNQRNRKSQNNMQIPLNKEEPEQRTIVVTNLNFELSDKEIRNYF
QQFGNIEDLIVPRNEGQLFNKGRAFVQYSTVAMAQLAAQKNGELFKGRPLEINLGLQSGV
NMNKKVPFMQNKGSKHQSKLLKSRSKSREKKSSRSKSNEDSYSRSRSRSRSSSSKRSSSR
SSSRSRSSNSGSQSQSRSRSNSQGEDKKSSSRRDSTQHNRHRDRYRNQDRRKNDSRSRSR
SQERRNSQHSRDNNRHYNRHQHGRQQYQNKNYQSQGQRGGQGQNRSNYNNNNGNRNYGGG
QRHGGQGSHYGGSGHRN


>TTHERM_000486877(gene)
ATGTTTACAAGTGTTAGAAAAAATAAAATAAAACCAGTATTGGGATCTGACAGAACCGAA
AAAAGCAAAACTGATTACAAAGAATCTATCGAAGAAGAAGATATTGAATTAGATATTGGA
GAAGACTTAGTTGATGATGATAAAGATGAAAAAGTTTAGTTATAGGAAAGATCTGATAAA
TAAAACAATCAGCAATAAGAAAACAATCCATCTAAGGAAAATAATAATAATGAAAGTGAT
ATTGAAGAAAAAGTAGTAGGAGGTGATTATGAAGAGCCAGAATTTTTAGGTGAAGAAGAA
GCGGAAGGTGAAAACGATGATAAAAAATATGATTGGATGGATTCCGATGACGAGGAAGAT
GGAGATGATTAAAAAAATGACCATGATAAAAACGATAGCAATAGCTCTCCTAATTAAAGT
AAATGTTTAAATCATGATTAAAATGATATTCAAGAATTAAATAATATTTTTAAAAATGGA
AAAGATGTTTTAGATTAATATCAAATATCATTTTTACTATTTGAAATTTAATTGAGATTG
CTTATGGCTATTACACAAACGCTATCTTATTTGATAGAAAAATTAATTATATTTGGAAAT
GAATAAAAATATATTTTTTAGATATGAGATTTCATAAATCTAAAAAATGAATTAATTAAT
CAATTAAAAAATATCCATACATTAAAGAATAAATAAATATTAATATGTCATATTTATCGT
TTGAATCTAATCATTAAAAGGGAACAGAAAAAGCTAGAACAATATGTAAATTCCTTTAAA
CAAAGAAGAAGTATCTTTCGTTATTCTACTTTATTTACTTTTCTTTTATACTTAATAGAA
AATTAGCTATTATAATCAAATTTATTAATTATCTAAATGAATACCCCATTTTGTCATATT
TATTCTTTTAAAATTTATTTTAATAAATTTGTTATTAAAAAAGCCTGAGTAGAGAACCAT
AGTTGTGACAAACTTAAATTTTGAGCTTTCAGATAAAGAAATAAGAAATTACTTCTAACA
ATTCGGTAACATTGAGTAAGGATTAAATATCATTTTATTTAATATCAGTCTCAATATCTA
TCGAAATAAAATAAAAAAGAAACAAATAAATAAATAAATTTACTTTTGGATTCATGCATA
TTTCGAATAAAATAGAAAAACTATAATAAAGCAGTTAATTTGTTTGAGAAAATGAGTTTT
ATTAGAAGTATTTTAAATTAGCAGATAATTTTATTTAGAAATAAAGCTACAAATAAAATA
TTCTCGATTATTTATTGAAAGAAAAACAAAATTTATTTAATAAAATAATACTGGTATTGG
CTGGGATATTATGCTTATATTCAACAAGAATAATAAAAAATATAAAATTTTAGAATTTCT
TTTTCAAAAGCAAATTTTAAAATAATCAAGAATTCTTTTACAGATTATTAATTATTTTTA
TTTAGAATTTTTTTCAAATGAATGTAAACAAAATAATAAATTATTAAGCTTGCAGTAGAG
TCAAATCTAAAGCATAGTAAAAGTTTTTGTTTCAAACAAACAAAAATAGCTGCAAACTAA
TTAATAAGAATATCTAAAATAATTTTTTGAGAGGCATAAAGCCATTTTTGAATTATTAAG
TTTAAATTTTTTTAAATGATTTTTAACTATCTATTACATATATTTTAAATTAATATGAAA
AGAGATTTAATTGTACCCAGAAATGAAGGATAACTATTTAACAAAGGAAGAGCGTTTGTT
TAATATTCTACAGTTGCTATGGCGTAATTGGTAAGAATTTCATATTATAGAGCTTAACTT
GATATTTAAATGATTTAATTAATTTTTGAGATATTCTTCAAATTAAATTAGACAGCAAAA
AAGATTTAAATTTAAATATTCTTTTAAAATATTTGTTGCATCTACAATTACATAAATGAT
AAAAAAAACATGAATTTATTATCTCATTAACTTGGATGTAAAATTTTGTTCTAAATCCAA
ATCATCATGAGGGAATTAAATTTTGGTTTTTGGAGCTTGTTTGTTTGAGTATATTATTGA
AACAATATTTTTAGAATCTATTCTAAATTTTCATATACTAACTAGCAGATCCTTTAATAT
TTAAATTAACTTATTTATTAATATTTGAAAGATTAATCAATATTTCCTCTCTCTGCTTTA
CTGCTCTAAATAAATACCATCATCAATCAGCTATTATTATTTTAATTACTTTTTGTTGAA
GACAGATTTTGATTAAAAAGAAAAAAACAAAATTAAAAACCCACTAAAAGATACCAAAAA
TTTTTAAATAATGAATAGTACCCTAAATTTAAGTATCTTGCTACTTTTAATTGAAATCAA
TTTAATTAAAGGGGTAGGAATTTATCTTTAGATATCAACAAATATGGCAATTTATTCCTA
ATATAATATACACTAGAAATGTTTGAGAGCATTTTTTTATAAATAAATTCATATTATTTT
CCCGCGATAATCTCTTCAACTAAAGCCATTTTATTCAATTAAAACAAAAAAAAATATTTT
TCACCTCATATTCGTTTTTTCAAATTATCATGAAGTTGATAAAATAGATTATCCAAAAAA
AATAATTAATCTAAATTCTTTTTTAATTGAGTGTCGTAATATTTAAAAATTTTTTATCCC
TTTTTCCATATTCTAATAAGATCATGCATGATACATCTATTGTATTTATTACTACCAAAT
AATTTGCATACATATGAATTACTCTTAAAGTTCTGAAAAAGAATTCCCTTTATATTAAAT
TGTAAAGCAGGGTATTTTAAATAAATGATTAAAATTAAATTGACTTCATATTTGAGTGAT
TAAATTAGCAGCTTTACAGATTTATTTAGATTTAATATAAAATAGAAAATAATTCAAAAT
TTCCCTCCATGATTTAAATTTTTTCATTTATTTTTAAATTAAACTTTTTTTAAATATTAA
AAATGCAAATTTTTTTAACAGTTACTTTATTTATTTTTATTAACATGCATATTATTTATG
GATATAAAAAGGCAGCTTAAAAAAATGGTGAATTGTTCAAAGGCCGTCCACTTGAAATCA
ACTTGGGTCTTTAATCAGGAGTGAATATGAACAAAAAAGTGTATTGATTTCTTATATGAT
ATAAGTCTTAGACATTTTTTAATTAAAATAAATATTAGACCTTTCATGTAAAATAAGGGC
AGCAAGCACTAATCAAAGCTACTAAAATCAAGAAGTAAAAGTAGGGAAAAGAAAAGTAGT
AGAAGTAAGAGTAATGAAGACAGCTATAGTAGAAGCAGAAGTAGAAGTAGAAGTAGTTCT
AGCAAACGTAGTAGCAGCAGAAGTAGCAGTAGAAGTCGTAGTAGTAACAGCGGTAGCTAG
AGCTAAAGTCGTAGTAGGAGTAATAGTTAAGGAGAAGATAAAAAAAGTTCTTCAAGAAGA
GATTCGACTTAGCATAATCGTCATAGGGATCGCTATAGAAACTAAGATAGAAGAAAAAAC
GATAGCCGCAGTAGATCTAGAAGCTAAGAAAGAAGAAACTCTTAGCACAGTCGTGATAAT
AACAGGCATTATAATCGTCACTAGCATGGCCGTCAATAATACTAAAACAAAAACTATTAA
AGTTAAGGGTAGAGAGGTGGTTAAGGCCAAAATAGAAGCAATTATAACAACAATAACGGT
AACCGCAATTATGGAGGTGGATAAAGGCACGGAGGTTAAGGATCACACTATGGTGGCAGT
GGACACAGAAATTGA