Identifiers and Description

Gene Model Identifier

TTHERM_00151210

Standard Name

RRM3 (RNA recognition motif-containing protein 3)

Aliases

PreTt20782 | 12.m00456 | 3700.m00176

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08648 ) Protein of unknown function (DUF1777)
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00151210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05083.19.997093137033517e-262hypothetical protein (568 aa)
OxytrichaContig1218.1.g1001.999534248571833e-46RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000066971.0000633497921574e-36locus:uaf-1 status:Confirmed
UniProt:Q8MXS2 protein_id
:CCD62281.1
DictyBaseDDB_G02863952.000130478826482e-26u2af2 on chromosome: 4 positio
n 4405482 to 4407497
Stentor CoeruleusSteCoe_197680.00000000000003442477108469977
SGDYPR112C0.00020003864201578029MRD1 Essential conserved prote
in that is part of the 90S pre
ribosome; required for product
ion of 18S rRNA and small ribo
somal subunit; contains five c
onsensus RNA-binding domains

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00151210(coding)
ATGGATAGAAAATAGAATAAAAAGGAATACAAAAGATCAAGATCTAGAAGTGAAAAGAAG
AGAAAGAAAGAAAAGAAGAGAAAGAATAAAGATAAGAAAAAAAAAGATAAGCATAGTAAG
AAGTCAGATAGAAGATACTCAGAATCTAGAAGCAGTAGTGAAAGTAGCAGATCAAGTAGA
AGCAATTCTCCTAATTAATAAGGAGGTAATGATGATAACAAAATAAAAATCATTCCTTTA
TCATTTCCTAGTAGTGGAAAGCCATAGTAAGAAATTACAACTCCTACATCTGCACAAGGC
GCTAGCACATCAAGTGCAATTCCATCTACTATACTTCAAATTGTAAATAAAGCGCAACAA
AATGTATAAGCAGCAGTTGCATCAAATACAAATCCCTTGAGAGAAAAGAGAAATGCGTTT
AGTTCACCACCAAAAAATACAGGTTCAAACGGATTTGGAGCTCCTGTCTCTGCTGGTGGA
TTAGAGATACCAGGTCTAGGAGGAATTAATATAGGATCAGCTGGAACTAGTGGATTTGAT
ATTGGCATCCCAGGTTTAGGTGGATTAGGAGGTTTTGGCTTACCTTAAGATACTTAAATT
ATTGGAAATAAAATCCCTCCTGCTCTTTAAAAGCAATACATACATGCACTGCGTGTTTAT
ATTGGAAATATCCCTGACCCCGTAGATGTAGAAGATGTTTGTAAATTTGTTTTTGAGCAG
ATGGCTAATGCTGGAGGATTATTAGAGCCAGGAAATCCAATTTAAAGCAAAAAGCATGAT
CCTATAAAAAAATTTATTTTCTTGTAGTTAAGATCTATTGAAGAAACATCTGCTTGTATG
GAGCTAGATGGTATTATTTATAAAGGAAAAAGTTTGAGATTCAGAAGACCAAAAGACTTT
GGTGTTTTGTAAAAAGTAGAAGGTACTCGTCCTGTACCTACTTTAGATAAGACTAAACTT
AAGATTGTTTAAACATAAGTAGAAAATACTTACAATAAGCTTTAAATTATGAATTTGCCT
GAAAATTTCAGCGAAGAGCATGTTATGCAACTATTATTAACTTATGGAGATCTAAAATCA
TTCCATTTGGCAGTTGATAAGATTACTAGTGAATCGAAGGGTTTTGCATTTTGTGAATTT
ATCACTGACAGATCAACTGTAGAATGCTTGAATAAATTAAGTGGTTAATAGATATTGAAT
AAAGTCATAAATGTCAAAAGATGTAATCCTTAACTTGCACCACAACATGAAGAACCGATT
CTTTCACTTGACTAGTTATACAAAAATTTAGTTGAAAACGTTAATAAGACAATCATTGAA
TCTGGCTAAAAGGATATCTAAGAAGATTATTTAAAGAAAATGCTATCAATAAATGCTCCT
AAATATGACGGGTTGATTACAGAAGATGCAACAAATGTGTTAAAGTTGCATAATATTGTC
AATAAGCAATTAATAGAGGAAGATGCGGAGTATCATTTTATTTTTAATGATTTGAAGACA
TAGCTCGATAGAATAGGAAGAACAAAATAAATTATAATTCCTAGAAAGAAAGACAAGTTC
TTAGAAGGAATCGGATTTGTTTTTGTAGAATTTGATAATGAAAGAACAAGCTAAATTGCA
AGCTTTTTACTTTAGAAAATCAAGTACGATGGTAAAGATGTTAAAGCAGAGTTTTACAGT
CCTTAATATTTTGCAGATAGAACATTCTATTGA


>TTHERM_00151210(protein)
MDRKQNKKEYKRSRSRSEKKRKKEKKRKNKDKKKKDKHSKKSDRRYSESRSSSESSRSSR
SNSPNQQGGNDDNKIKIIPLSFPSSGKPQQEITTPTSAQGASTSSAIPSTILQIVNKAQQ
NVQAAVASNTNPLREKRNAFSSPPKNTGSNGFGAPVSAGGLEIPGLGGINIGSAGTSGFD
IGIPGLGGLGGFGLPQDTQIIGNKIPPALQKQYIHALRVYIGNIPDPVDVEDVCKFVFEQ
MANAGGLLEPGNPIQSKKHDPIKKFIFLQLRSIEETSACMELDGIIYKGKSLRFRRPKDF
GVLQKVEGTRPVPTLDKTKLKIVQTQVENTYNKLQIMNLPENFSEEHVMQLLLTYGDLKS
FHLAVDKITSESKGFAFCEFITDRSTVECLNKLSGQQILNKVINVKRCNPQLAPQHEEPI
LSLDQLYKNLVENVNKTIIESGQKDIQEDYLKKMLSINAPKYDGLITEDATNVLKLHNIV
NKQLIEEDAEYHFIFNDLKTQLDRIGRTKQIIIPRKKDKFLEGIGFVFVEFDNERTSQIA
SFLLQKIKYDGKDVKAEFYSPQYFADRTFY


>TTHERM_00151210(gene)
ATGGATAGAAAATAGAATAAAAAGGAATACAAAGTAATTAAACTATTTTTATTTAAAAAG
GATTCTATACTAAATAATCTACTCTATATGTTAAAGACATGATTATAAATTTAAATTTAT
GATTTAGACTTACTAATGGTTGATAAGTCATTTTTGAAAAATGTTTTTATAATAGAGATC
AAGATCTAGAAGTGAAAAGAAGAGAAAGAAAGAAAAGAAGAGAAAGAATAAAGATAAGAA
AAAAAAAGATAAGCATAGTAAGAAGTCAGATAGAAGATACTCAGAATCTAGAAGCAGTAG
TGAAAGTAGCAGATCAAGTAGAAGCAATTCTCCTAATTAATAAGGAGGTAATGATGATAA
CAAAATAAAAATCATTCCTTTATCATTTCCTAGTAGTGGAAAGCCATAGTAAGAAATTAC
AACTCCTACATCTGCACAAGGCGCTAGCACATCAAGTGCAATTCCATCTACTATACTTCA
AATTGTAAATAAAGCGCAACAAAATGTATAAGCAGCAGTTGCATCAAATACAAATCCCTT
GAGAGAAAAGAGAAATGCGTTTAGTTCACCACCAAAAAATACAGGTTCAAACGGATTTGG
AGCTCCTGTCTCTGCTGGTGGATTAGAGATACCAGGTCTAGGAGGAATTAATATAGGATC
AGCTGGAACTAGTGGATTTGATATTGGCATCCCAGGTTTAGGTGGATTAGGAGGTTTTGG
CTTACCTTAAGATACTTAAATTATTGGAAATAAAATCCCTCCTGCTCTTTAAAAGCAATA
CATACATGCACTGTAATTTAATAGAAACATTATTATTTATAAATTTCTATCAAAAATAGT
TAAAATAGTTTTTATAAAACATCAAAACATTTTGATTAAAAAGAGGCACTCAATTTAACC
AAATCTAATAAAATTTTTAGAGCATTTTTACTTTTTTTCTTAAAACAATTTAGATAGATC
AAGTAAAATATTAAAATATTAAAATTTTTTATAAAATTATCAGGCGTGTTTATATTGGAA
ATATCCCTGACCCCGTAGATGTAGAAGATGTTTGTAAATTTGTTTTTGAGCAGATGGCTA
ATGCTGGAGGATTATTAGAGCCAGGAAATCCAGTAAATAATTATATTTTTAACAATTGAA
TATTTAATTAATAAATTTATTATGAATTAAAAAAGATTTAAAGCAAAAAGCATGATCCTA
TAAAAAAATTTATTTTCTTGTAGTTAAGATCTATTGAAGAAACATCTGCTTGTATGGAGC
TAGATGGTATTATTTATGTAAATAGGTTTGTTTGCACATAAATGATCTTTAAATTTAAAT
ATCTTTATTATAACAACTATAAAGAAAGGAAAAAGTTTGAGATTCAGAAGACCAAAAGAC
TTTGGTGTTTTGTAAAAAGTAGAAGGTACTCGTCCTGTACCTACTTTAGATAAGACTAAA
CTTAAGATTGTTTAAACATAAGTAGAAAATACTTACAATAAGGTAAAAATTAATTGCTTG
CTAAAAAACTAATTATTTTTTTAATTTTAAATAGCTTTAAATTATGAATTTGCCTGAAAA
TTTCAGCGAAGAGCATGTTATGCAACTATTATTAACTTATGGGTATGATTAGATCAATTA
TTTATTATTTATTAATGAATTATATAAAATAGAGATCTAAAATCATTCCATTTGGCAGTT
GATAAGATTACTAGTGAATCGAAGGGTTTTGCATTTTGTGAATTTATCACTGACAGATCA
ACTGTAGAATGCTTGAATAAATTAAGTGGTTAATAGATATGTAATTCTTTTTTATTAAAA
ATTTTCTTTGTAAATAAGTGAATTAAATTTTTGAAATTAGTGAATAAAGTCATAAATGTC
AAAAGATGTAATCCTTAACTTGCACCACAACATGAAGAACCGATTCTTTCACTTGACTAG
TTATACAAAAATTTAGTTGAAAACGTTAATAAGACAATCATTGAATCTGGCTAAAAGGAT
ATCTAAGAAGATTATTTAAAGAAAATGCTATCAATAAATGCTCCTAAATATGACGGGTTG
ATTACAGAAGATGCAACAAATGTGTTAAAGTTGCATAATATTGTCAATAAGCAATTAATA
GAGGAAGATGCGGAGTATCATTTTATTTTTAATGATTTGAAGACATAGCTCGATAGAATA
GGAAGAACAAAATAAATTATAATTCCTAGAAAGAAAGACAAGTTCTTAGAAGGAATCGGA
TTTGTTTTTGTAGAATTTGATAATGAAAGAACAAGCTAAATTGCAAGCTTTTTACTTTAG
GTTTAACATTTTTAATTTAGTTTTATTTTATATTTAACTGGCTAATTGTTATTAAATATA
GAAAATCAAGTACGATGGTAAAGATGTTAAAGCAGAGTTTTACAGTCCTTAATATTTTGC
AGATAGAACATTCTATTGA