Identifiers and Description

Gene Model Identifier

TTHERM_00485820

Standard Name

RRM29 (RNA Recognition Motif-containing protein 29)

Aliases

PreTt19514 | 59.m00152 | 3680.m00009

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08164 ) TRAUB (NUC102) domain
  • ( PF02714 ) Domain of unknown function DUF221
  • ( PF00902 ) Sec-independent protein translocase protein (TatC)
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00485820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12084.19.997093137033517e-262hypothetical protein (955 aa)
OxytrichaContig20945.0.g409.997441244797434e-45Domain of unknown function DUF
221
Stentor CoeruleusSteCoe_362995.242885663363464e-22

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00485820(coding)
ATGAGAAGCAATAATGCTTCATAGCATATTTCTGAAAATAATGCTCTTGTTTAATTTCAT
ATTAACCATAAAAATATAGAGTAAGATGAAAATCTTATAATGTTTGATTCTGGTAATTCA
GTTCAAATAAAGTAATCTCAAAATCAAGATGAGCCTAAGGCAAACAACGCTGGAATATAT
AGTTTAGTTTACAAAAAAGATATTGTTAGCAACGAAAATCGGTCAATGAATTCTTAAAGA
GACTAGGCGAAGGAAGTTTTTGAAGTTATTATTGATAATGACTCAAATACAAATGAAAGA
AATAGTCGTATGGAGTTAAAGAATGGGAACAACCATCTTTAAAATCCTCATGTCAATATA
CATAGGGCATCAACTAAAAAAAAGAGCAACATTCATTTTCATGCTGGTGGACATAAGCAT
GAAGGATTTGATCCTTTTAAAATTCCTTGTGATTGGGAAAAAGCTAAGTTGCATGCTTAA
TCTAGAGAAACAAAACCTGAATTAGATTCTGAAGAAGTACTCTCACCAGATGGCTAATAA
GCTGAGAAAAAAATGTAAGAGGTTTGTGACTGCTGTGGTTATGAGTTAAAAAGGAAAGAA
ATAGGTCTTAATGTAGATACTATGGAGTTAGGTTTTATGGGATCAGGTTTCCCACTGTAT
TTTAACTATATCAAATATTGCTGCCTTATGCTTTTTTTCCTATTTTGCATTTAAGGAATC
CCAAACCTAGTCTACAATATTCAAGGTGAATTTTGCCATTCTGACCCTGTTGAAGTCTTC
GCTGCTATTGAAGAAAACCATGATCATCATTAAGCCTACTTTTTAATCCCTTGTCCTGAT
ACAAATTTAAATAAGATTTCGATGGCTAATGTTTTAGATAAAATGTACAGAGAAACAAAT
TACGACTTTCACTTTTCTATTGCAGCAGTCATAGTGTAGTTATTACTGAATATTTTATTC
AGAAGAAGCCAGAGAAAAATAGAATAAGATGTTGATATTGCCTGCAGCACACCTTCTGAT
TACACAATTATGGTTCAAAATATAAGTTAGAATATAACTAATATAAAAGAAACCTTGAAG
GAAATATTTGAGTAATATGGTACAGTAGAAAAAATAAATTTGGTTTATGATATCACAGAC
CTCGAGCATATAGAAACATAAATTAAAAAAAAGGTACAGTAGAAACAGAAAATAATTGAT
AAGATTTAAAGTTTTGATCCTAATAATAAAGAAATTTAAGAAATTGATCATCAAATAGAA
AAGTTGGAAGAAGAAGTTCATTAAATGCAAATATAAATGTAGGCTGACAATAAAAGATTT
GTAGGAACAGCATTTATAAGTTTTTCAAGAGAAGAAGAAAAGTAAAAAGCAATTAAATCA
AACCCATAAGATGGATGGAAAAGATTTAAAGACTACTTTAAAGATGGTAAATCATAACAT
TCAAAAAAAGACTAGCTTTATTTAGATGGAAGATATTTATATATATCAGAAGCTCCTGAG
CCAAATGACGTCGATTGGGAGTTTGCCCATGTAAAAACAGTAGAAAAAATTAAAGTTAGA
ACAATTGCATTTTTTAAATGGTTGATTTTAACACTTGCATCTTTTGTTGTTATAGCTCTT
ATATCTTATCTCTAAAGTAATACCATAGATCATATTTTGAAATAAGAGCATGATATTGCA
ATCGAAAGCGAAGGAAGAGAAATGACTGAAGAAGAGTAGCATCATTACGATGATCTCTAA
TCTCAAAAAACTTCTGTCACAGTTTTATCATTTGTTATTTCCAGTATTATAGTCATTTGG
AATAAATTTTTCTTGCCTTTTATAATCCATAAGATTTGTGATCACGAAAAATGGGCTACT
AAGACAAGTCTAAACGTATCCTTTGCATACAAGTTAACTATTGGTCTTTTCTTCAATACC
GCTCTCATCACATTCTTTGTTGAAATTATTTTCTTCTAAAATATTTACGCACTAGCTGGA
GGTATGATATACAATGAATTCTTGATTTTTATCATAAACGCCGTTGTTCCAGCATTAGCA
TGGATTATTGATCCTTGGAAAATTTGGTAAGATTTTAAAAGAAATAGATAAATAAAGAAG
AAAGTCTGTTCTTTAACTTAATAAGAAGCTAACTCATTAATGGAACATCCTAGCTACACT
CAAGGTAAAAGATATGCCGATATTATGAAAACTATGTGGTTCACTTTCTTTTATTCACCA
ATCATACCCATAGGAACTGTTATTTCTCTAGGTGGTTTGATTGCTTACTATATCACTGAT
AAATACAACCTTATTTTTAGAAGAACTGTAAAAGAATCTATATCTTCAAGACTTTCAATG
TAAATGATTGAACTCGTTGAACTTTCTATCATTTTCCATACATTTGGATAAGTTTTTTTC
AAATGGTTTATGAGCTATTACATTGATGTTGGAAATTTCTTTTTATTTATTGCTGTCTGC
ATAGTTGTAGTCATTATTCCTATGGATAAAATAAACGAGTTTTTATTCCCTCTTGGAGAC
TCAGATGAAGAGAAGACATACAAAGAAGTTCATTTAGATTTTGATACCGATTATGATAGA
GAAAATCCTGTTACAAGAAAAGAAAGTTTAATACACTTTTAGAATCTAAGAAATGGTATT
ATTACAGTTGTAGATGCATATAAAGCCGCATAAAATATGGTATAATTTGCTCATCACCAT
AGAGCAAGTCCAATGCACTAAGATGATAAACTTGTGTAAGAACTTTAAAGCATGCAAAAA
GACAGTAGCAAAAACAATAATTAGAACGCTGATAATATCTAAAATAACTAAACTAAATCT
AATACTCAGAATGTTCTAAGCAACGGAGAAATTTAAGTTTGA


>TTHERM_00485820(protein)
MRSNNASQHISENNALVQFHINHKNIEQDENLIMFDSGNSVQIKQSQNQDEPKANNAGIY
SLVYKKDIVSNENRSMNSQRDQAKEVFEVIIDNDSNTNERNSRMELKNGNNHLQNPHVNI
HRASTKKKSNIHFHAGGHKHEGFDPFKIPCDWEKAKLHAQSRETKPELDSEEVLSPDGQQ
AEKKMQEVCDCCGYELKRKEIGLNVDTMELGFMGSGFPLYFNYIKYCCLMLFFLFCIQGI
PNLVYNIQGEFCHSDPVEVFAAIEENHDHHQAYFLIPCPDTNLNKISMANVLDKMYRETN
YDFHFSIAAVIVQLLLNILFRRSQRKIEQDVDIACSTPSDYTIMVQNISQNITNIKETLK
EIFEQYGTVEKINLVYDITDLEHIETQIKKKVQQKQKIIDKIQSFDPNNKEIQEIDHQIE
KLEEEVHQMQIQMQADNKRFVGTAFISFSREEEKQKAIKSNPQDGWKRFKDYFKDGKSQH
SKKDQLYLDGRYLYISEAPEPNDVDWEFAHVKTVEKIKVRTIAFFKWLILTLASFVVIAL
ISYLQSNTIDHILKQEHDIAIESEGREMTEEEQHHYDDLQSQKTSVTVLSFVISSIIVIW
NKFFLPFIIHKICDHEKWATKTSLNVSFAYKLTIGLFFNTALITFFVEIIFFQNIYALAG
GMIYNEFLIFIINAVVPALAWIIDPWKIWQDFKRNRQIKKKVCSLTQQEANSLMEHPSYT
QGKRYADIMKTMWFTFFYSPIIPIGTVISLGGLIAYYITDKYNLIFRRTVKESISSRLSM
QMIELVELSIIFHTFGQVFFKWFMSYYIDVGNFFLFIAVCIVVVIIPMDKINEFLFPLGD
SDEEKTYKEVHLDFDTDYDRENPVTRKESLIHFQNLRNGIITVVDAYKAAQNMVQFAHHH
RASPMHQDDKLVQELQSMQKDSSKNNNQNADNIQNNQTKSNTQNVLSNGEIQV


>TTHERM_00485820(gene)
ATGAGAAGCAATAATGCTTCATAGCATATTTCTGAAAATAATGCTCTTGTTTAATTTCAT
ATTAACCATAAAAATATAGAGTAAGATGAAAATCTTATAATGTTTGATTCTGGTAATTCA
GTTCAAATAAAGTAATCTCAAAATCAAGATGAGCCTAAGGCAAACAACGCTGGAATATAT
AGTTTAGTTTACAAAAAAGATATTGTTAGCAACGAAAATCGGTCAATGAATTCTTAAAGA
GACTAGGCGAAGGAAGTTTTTGAAGTTATTATTGATAATGACTCAAATACAAATGAAAGA
AATAGTCGTATGGAGTTAAAGAATGGGAACAACCATCTTTAAAATCCTCATGTCAATATA
CATAGGGCATCAACTAAAAAAAAGAGCAACATTCATTTTCATGCTGGTGGACATAAGCAT
GAAGGATTTGATCCTTTTAAAATTCCTTGTGATTGGGAAAAAGCTAAGTTGCATGCTTAA
TCTAGAGAAACAAAACCTGAATTAGATTCTGAAGAAGTACTCTCACCAGATGGCTAATAA
GCTGAGAAAAAAATGTAAGAGGTTTGTGACTGCTGTGGTTATGAGTTAAAAAGGAAAGAA
ATAGGTCTTAATGTAGATACTATGGAGTTAGGTTTTATGGGATCAGGTTTCCCACTGTAT
TTTAACTATATCAAATATTGCTGCCTTATGCTTTTTTTCCTATTTTGCATTTAAGGAATC
CCAAACCTAGTCTACAATATTCAAGGTGAATTTTGCCATTCTGACCCTGTTGAAGTCTTC
GCTGCTATTGAAGAAAACCATGATCATCATTAAGCCTACTTTTTAATCCCTTGTCCTGAT
ACAAATTTAAATAAGATTTCGATGGCTAATGTTTTAGATAAAATGTACAGAGAAACAAAT
TACGACTTTCACTTTTCTATTGCAGCAGTCATAGTGTAGTTATTACTGAATATTTTATTC
AGAAGAAGCCAGAGAAAAATAGAATAAGATGTTGATATTGCCTGCAGCACACCTTCTGAT
TACACAATTATGGTTCAAAATATAAGTTAGAATATAACTAATATAAAAGAAACCTTGAAG
GAAATATTTGAGTAATATGGTACAGTAGAAAAAATAAATTTGGTTTATGATATCACAGAC
CTCGAGCATATAGAAACATAAATTAAAAAAAAGGTACAGTAGAAACAGAAAATAATTGAT
AAGATTTAAAGTTTTGATCCTAATAATAAAGAAATTTAAGAAATTGATCATCAAATAGAA
AAGTTGGAAGAAGAAGTTCATTAAATGCAAATATAAATGTAGGCTGACAATAAAAGATTT
GTAGGAACAGCATTTATAAGTTTTTCAAGAGAAGAAGAAAAGTAAAAAGCAATTAAATCA
AACCCATAAGATGGATGGAAAAGATTTAAAGACTACTTTAAAGATGGTAAATCATAACAT
TCAAAAAAAGACTAGCTTTATTTAGATGGAAGATATTTATATATATCAGAAGCTCCTGAG
CCAAATGACGTCGATTGGGAGTTTGCCCATGTAAAAACAGTAGAAAAAATTAAAGTTAGA
ACAATTGCATTTTTTAAATGGTTGATTTTAACACTTGCATCTTTTGTTGTTATAGCTCTT
ATATCTTATCTCTAAAGTAATACCATAGATCATATTTTGAAATAAGAGCATGATATTGCA
ATCGAAAGCGAAGGAAGAGAAATGACTGAAGAAGAGTAGCATCATTACGATGATCTCTAA
TCTCAAAAAACTTCTGTCACAGTTTTATCATTTGTTATTTCCAGTATTATAGTCATTTGG
AATAAATTTTTCTTGCCTTTTATAATCCATAAGATTTGTGATCACGAAAAATGGGCTACT
AAGACAAGTCTAAACGTATCCTTTGCATACAAGTTAACTATTGGTCTTTTCTTCAATACC
GCTCTCATCACATTCTTTGTTGAAATTATTTTCTTCTAAAATATTTACGCACTAGCTGGA
GGTATGATATACAATGAATTCTTGATTTTTATCATAAACGCCGTTGTTCCAGCATTAGCA
TGGATTATTGATCCTTGGAAAATTTGGTAAGATTTTAAAAGAAATAGATAAATAAAGAAG
AAAGTCTGTTCTTTAACTTAATAAGAAGCTAACTCATTAATGGAACATCCTAGCTACACT
CAAGGTAAAAGATATGCCGATATTATGAAAACTATGTGGTTCACTTTCTTTTATTCACCA
ATCATACCCATAGGAACTGTTATTTCTCTAGGTGGTTTGATTGCTTACTATATCACTGAT
AAATACAACCTTATTTTTAGAAGAACTGTAAAAGAATCTATATCTTCAAGACTTTCAATG
TAAATGATTGAACTCGTTGAACTTTCTATCATTTTCCATACATTTGGATAAGTTTTTTTC
AAATGGTTTATGAGCTATTACATTGATGTTGGAAATTTCTTTTTATTTATTGCTGTCTGC
ATAGTTGTAGTCATTATTCCTATGGATAAAATAAACGAGTTTTTATTCCCTCTTGGAGAC
TCAGATGAAGAGAAGACATACAAAGAAGTTCATTTAGATTTTGATACCGATTATGATAGA
GAAAATCCTGTTACAAGAAAAGAAAGTTTAATACACTTTTAGAATCTAAGAAATGGTATT
ATTACAGTTGTAGATGCATATAAAGCCGCATAAAATATGGTATAATTTGCTCATCACCAT
AGAGCAAGTCCAATGCACTAAGATGATAAACTTGTGTAAGAACTTTAAAGCATGCAAAAA
GACAGTAGCAAAAACAATAATTAGAACGCTGATAATATCTAAAATAACTAAACTAAATCT
AATACTCAGAATGTTCTAAGCAACGGAGAAATTTAAGTTTGA