Identifiers and Description

Gene Model Identifier

TTHERM_00484731

Standard Name

RRM28 (RNA Recognition Motif-containing protein 28)

Aliases

3719.m00872

Description

RRM28 splicing factor u2af large subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00332 ) desulfoferrodoxin ferrous iron-binding domain
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_00484731

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14252.29.997093137033517e-262hypothetical protein (596 aa)
OxytrichaContig1218.1.g1003.000842737734004e-34RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000066979.995528898049344e-31locus:uaf-1 status:Confirmed
UniProt:Q8MXS2 protein_id
:CCD62281.1
DictyBaseDDB_G02863955.998760051700188e-30u2af2 on chromosome: 4 positio
n 4405482 to 4407497
Stentor CoeruleusSteCoe_197680.00000000003775134544279098
SGDYIL061C0.00000030014504373857585SNP1 Component of U1 snRNP req
uired for mRNA splicing via sp
liceosome; substrate of the ar
ginine methyltransferase Hmt1p
; may interact with poly(A) po
lymerase to regulate polyadeny
lation; homolog of human U1 70
K protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00484731(protein)
MSFQNQEIHDDLNEMQKLTEAQEEQFKQQNDNDYDQVGTSGYQEIIKRSRENSIDSARSR
SRSINERKRNYNRQQNSNEEESPKMVNKVEVPVIKLDNQSGYRHARRLYIGNIPETINQE
YLSEWLYRSLEAAGGLQPSLPSENPIVKCEIDPKGRFAFTELRSIEETTALLQLDGIILW
HRQLRIRRPTEYEKFPKVQGQFEANIPKLNFDLFKTVGIVIIPTIVDDGPNKIFLANLPT
KMDELMILDELKLRDMGEIKAFHLVKDNQTNQSKGYAFFEFKDPSLTDNCIETLHGMQYA
GRTLTCKRSQIGGLGNKQMSTGNNKQNNNRNSNQQNNLGGNNNMQRQSFSSENIDSIQGQ
NQQGINEGSGFFPNYQSNTQGGGNNQNKGMNQNYQNNGNNHNNNNKRGRNFGNQNNSNNN
YYNNNGAGMNNGNNNNNGNNRRFQNNNNMNHNQQGQFTNGGNKFNKGHGNNNGMSNKKQN
QWNGQQNNQIPSQDNQTGISSDGYYEGSSSQIGQQYDVSQMYNYQQSQQGSHYMMQDQSN
PYQ


>TTHERM_00484731(coding)
ATGAGTTTTCAAAATCAAGAAATTCACGATGACTTGAATGAAATGTAAAAGCTAACTGAA
GCATAGGAAGAACAATTCAAGCAACAAAATGACAATGACTATGATTAAGTAGGAACAAGT
GGTTATTAAGAAATAATCAAAAGATCAAGAGAAAATTCGATAGATTCAGCCCGTTCGCGC
TCAAGATCAATCAATGAAAGAAAGAGAAATTATAACAGATAGCAAAATAGCAACGAAGAA
GAGAGTCCAAAGATGGTCAATAAAGTAGAAGTACCTGTGATTAAGTTAGATAACTAATCA
GGATATCGTCACGCTAGACGTCTTTATATTGGTAACATTCCTGAAACTATTAATTAAGAA
TATCTAAGTGAATGGCTTTATCGTTCTCTTGAAGCAGCTGGAGGTCTTTAGCCTTCTTTG
CCCTCAGAAAATCCAATAGTAAAATGTGAAATTGATCCTAAAGGAAGGTTTGCATTTACT
GAGTTAAGGTCAATTGAAGAAACCACTGCTTTGCTTCAATTAGATGGAATTATTTTGTGG
CACAGATAATTAAGAATAAGAAGACCTACTGAATATGAAAAGTTCCCTAAGGTTCAAGGA
CAATTTGAAGCTAATATTCCCAAATTGAATTTCGATCTTTTCAAAACTGTTGGAATAGTA
ATTATTCCTACTATTGTTGATGATGGTCCTAACAAGATATTCTTGGCTAACTTGCCCACT
AAGATGGATGAGTTAATGATTTTAGATGAATTAAAACTTAGAGATATGGGTGAAATTAAA
GCATTCCATTTAGTTAAAGATAATCAAACTAACTAAAGTAAGGGATATGCCTTTTTTGAA
TTCAAAGATCCTTCTCTTACTGATAATTGTATAGAGACATTACATGGTATGCAATATGCT
GGTAGAACTCTTACATGCAAGAGATCTTAAATAGGAGGCTTAGGCAATAAATAAATGTCA
ACAGGAAACAATAAATAAAACAATAATAGAAATAGCAATCAGTAAAATAACTTAGGTGGT
AATAATAACATGCAAAGATAGAGTTTCTCTTCAGAAAATATTGATTCTATATAGGGATAA
AACTAATAAGGTATCAATGAAGGCAGTGGATTCTTTCCCAATTACTAATCAAACACACAA
GGTGGTGGAAATAACTAAAACAAGGGTATGAACTAAAATTATCAAAATAATGGCAATAAT
CATAACAACAATAATAAAAGAGGAAGAAACTTTGGAAATTAAAATAACTCAAATAACAAT
TACTACAATAATAATGGGGCAGGAATGAATAATGGTAATAACAATAATAATGGAAACAAT
AGAAGATTCTAAAATAACAACAATATGAATCACAATTAGTAAGGTTAGTTTACAAACGGA
GGAAATAAATTCAATAAAGGGCATGGTAACAACAACGGAATGAGTAACAAGAAGTAAAAT
TAATGGAACGGTTAGCAAAATAATTAAATCCCAAGCTAAGATAATTAAACTGGTATCTCC
TCTGATGGATATTATGAAGGAAGTAGTAGCTAAATTGGCTAATAATATGATGTTAGCTAA
ATGTACAACTATCAATAATCATAACAAGGATCTCATTATATGATGCAAGACTAATCTAAT
CCTTATTAATGA


>TTHERM_00484731(gene)
ATGAGTTTTCAAAATCAAGAAATTCACGATGACTTGAATGAAATGTAAAAGCTAACTGAA
GCATAGGAAGAACAATTCAAGCAACAAAATGACAATGACTATGATTAAGTAGGAACAAGT
GGTTATTAAGAAATAATCAAAAGATCAAGAGAAAATTCGATAGATTCAGCCCGTTCGCGC
TCAAGATCAATCAATGAAAGAAAGAGAAATTATAACAGATAGCAAAATAGCAACGAAGAA
GAGAGTCCAAGTAATATAAATCAAAATAGCAGGCCTGTTGCTTAGAGAAGCAATCATTTC
TTTGAGTAAAATGATGAATAGAATGAATAAAATTTAGGAGAAAATGATTTGAATAGTAAC
AACACAACTGGAGTTGATTTTAGTAAAATGAATTTCAACTAAAGTTTGTAATAACTTTAA
GAGATGGTCAATAAAGTAGAAGTACCTGTGATTAAGTTAGATAACTAATCAGGATATCGT
CACGCTAGGTATAATTTCATAGATTAATAAATTTACTAAATAACCACGGTATTTTCCTTC
CTGATTAATAAAAGCAGCTTTAATAACATAGCTCTGCTTTAATTGCATTAAGTAATGCTA
TTTTGCAGAAACATGTTGTTTTAAAGAGCATACTTTTGAAGCTGAAAGAAGAAAAAAAAC
TAAATAAATAACTTCGCCATAATATCAAAAGCAAACAAGCAAGAAAAAAAAACAAACAAA
CAAACAAACCTAATTTTCTTCCCCACTCTTTTTCAAATTTTTTCTCTTTACCATTTTTGT
AGCAATAAAAAAATCATCTTATTTTCTGTTTCTTTGATTTTTTATCATTGACCACCCCTC
ACAAATAATTTACAAAAAACTTTCTAATCCCCCTCCTTTCAATATTTTGCTTTGTATTAT
AAAGCAAAATCTATTTATCTATCTATCTAATCTTATCTCTCATTCATTCATTTATTCAAT
CTTTCTTCATTGATTCTTATTTTTTTTCTTTCTAATTTACCATGAATACATACTTATATT
ATATGTATATAATATTTTATAATCATATTATAATTAGCACCATACTTTATCATCAATAGC
AATTATTAAAAAATAAATCTTAATTTCTTTTCCTTCTTTTTCAATCAAATAAAGAATTTA
AAATTATTTTTTTCCCCCTCTTTTCTTCAATCTTTTTTTATTTATGACTGACCAAAAATT
AATTTTAAAAACTATATGCTACCTGTTTTTTCAAATATCTTCTTTTTCATTCTTTTTAAT
AGAAAAAGTCAACAAAAGAGAATTACATGATATTATACATTTATGAATCATCAAATATTT
TGTAGTATTTACTGCTTTCTCTCTTCTTTCTTCTTTTATTTTTTGCTTCTGCTCTAAATA
TTCATTCATTCATTTATTATTATTCTTCATATGTTATTTAATTTTACTTAAAATTGTTCA
TTTAAAATCATTTTAGTAGAAAAAGTATCTCTCCTTTACGTACCATTTAATTTTTTTAAA
ATTAGAAAGAAAACAAATAAACAAACATTCATATAAATAAACTAACTATTTACAGGATTG
ATTTAGGGTTGAAACAAATAAAAATAAACAAATAATAATGTATTATAAGTTGAGGGAAAG
ATCCGTATCACCTTCAAAGATATTTAAATAAAAAAAATCTTCTCATACAGTTTTAATATG
ATTCGATATCAATAGCTTTTTAATATTGCTATTTCGTGATATTTTTGAATTTAAATCAGG
AAAATATGCCGCTAATTTTAATATTTTTGAAATTTCATGAATTAATTAATTTAATTATAG
ACGTCTTTATATTGGTAACATTCCTGAAACTATTAATTAAGAATATCTAAGTGAATGGCT
TTATCGTTCTCTTGAAGCAGCTGGAGGTCTTTAGCCTTCTTTGCCCTCAGAAAATCCAGT
AAAAAATTTTATTAATAAATATTTCTAAAATTAAAAATATTATTTTTAACTTTATAAAAG
ATAGTAAAATGTGAAATTGATCCTAAAGGAAGGTTTGCATTTACTGAGTTAAGGTCAATT
GAAGAAACCACTGCTTTGCTTCAATTAGATGGAATTATTTTGGTAATAAAATAAACAATA
AAACATTTTATAATTTTAATTAATTAATTAATTAAAAAATTAGTGGCACAGATAATTAAG
AATAAGAAGACCTACTGAATATGAAAAGTTCCCTAAGGTTCAAGGACAATTTGAAGCTAA
TGTAATTAATTAATTTCAATTATTTTAATTATTTAATTTTACTTATTTAAAATAGATTCC
CAAATTGAATTTCGATCTTTTCAAAACTGTTGGAATAGTAATTATTCCTACTATTGTTGA
TGATGGTCCTAACAAGATATTCTTGGCTAACTTGCCCACTAAGATGGATGAGTTAATGAT
TTTAGATGAATTAAAACTTAGAGATATGGGGTAATAATTTACTTTTGATTATATATTTTA
AAACTTGTTAATTCATATTTTTTTGATTAAAACAGTGAAATTAAAGCATTCCATTTAGTT
AAAGATAATCAAACTAACTAAAGTAAGGGATATGCCTTTTTTGAATTCAAAGATCCTTCT
CTTACTGATAATTGTATAGAGACATTACATGGTATGCAATATGCTGGTAGAACTCTTACA
TGCAAGAGATCTTAAATAGGAGGCTTAGGCAATAAATAAATGTCAACAGGAAACAATAAA
TAAAACAATAATAGAAATAGCAATCAGTAAAATAACTTAGGTGGTAATAATAACATGCAA
AGATAGAGTTTCTCTTCAGAAAATATTGATTCTATATAGGGATAAAACTAATAAGGTATC
AATGAAGGCAGTGGATTCTTTCCCAATTACTAATCAAACACACAAGGTGGTGGAAATAAC
TAAAACAAGGGTATGAACTAAAATTATCAAAATAATGGCAATAATCATAACAACAATAAT
AAAAGAGGAAGAAACTTTGGAAATTAAAATAACTCAAATAACAATTACTACAATAATAAT
GGGGCAGGAATGAATAATGGTAATAACAATAATAATGGAAACAATAGAAGATTCTAAAAT
AACAACAATATGAATCACAATTAGTAAGGTTAGTTTACAAACGGAGGAAATAAATTCAAT
AAAGGGCATGGTAACAACAACGGAATGAGTAACAAGAAGTAAAATTAATGGAACGGTTAG
CAAAATAATTAAATCCCAAGCTAAGATAATTAAACTGGTATCTCCTCTGATGGATATTAT
GAAGGAAGTAGTAGCTAAATTGGCTAATAATATGATGTTAGCTAAATGTACAACTATCAA
TAATCATAACAAGGATCTCATTATATGATGCAAGACTAATCTAATCCTTATTAATGA