Identifiers and Description

Gene Model Identifier

TTHERM_00484731

Standard Name

RRM28 (RNA Recognition Motif-containing protein 28)

Aliases

3719.m00872

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00332 ) desulfoferrodoxin ferrous iron-binding domain
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_00484731

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14252.29.997093137033517e-262hypothetical protein (596 aa)
OxytrichaContig1218.1.g1003.000842737734004e-34RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000066979.995528898049344e-31locus:uaf-1 status:Confirmed
UniProt:Q8MXS2 protein_id
:CCD62281.1
DictyBaseDDB_G02863955.998760051700188e-30u2af2 on chromosome: 4 positio
n 4405482 to 4407497
Stentor CoeruleusSteCoe_197680.00000000003775134544279098
SGDYIL061C0.00000030014504373857585SNP1 Component of U1 snRNP req
uired for mRNA splicing via sp
liceosome; substrate of the ar
ginine methyltransferase Hmt1p
; may interact with poly(A) po
lymerase to regulate polyadeny
lation; homolog of human U1 70
K protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00484731(protein)
FFRILQLKFYRLKLVKKIKQILKAKMSFQNQEIHDDLNEMQKLTEAQEEQFKQQNDNDYD
QVGTSGYQEIIKRSRENSIDSARSRSRSINERKRNYNRQQNSNEEESPSNINQNSRPVAQ
RSNHFFEQNDEQNEQNLGENDLNSNNTTGVDFSKMNFNQSLQQLQEMVNKVEVPVIKLDN
QSGYRHARRLYIGNIPETINQEYLSEWLYRSLEAAGGLQPSLPSENPIVKCEIDPKGRFA
FTELRSIEETTALLQLDGIILWHRQLRIRRPTEYEKFPKVQGQFEANIPKLNFDLFKTVG
IVIIPTIVDDGPNKIFLANLPTKMDELMILDELKLRDMGEIKAFHLVKDNQTNQSKGYAF
FEFKDPSLTDNCIETLHGMQYAGRTLTCKRSQIGGLGNKQMSTGNNKQNNNRNSNQQNNL
GGNNNMQRQSFSSENIDSIQGQNQQGINEGSGFFPNYQSNTQGGGNNQNKGMNQNYQNNG
NNHNNNNKRGRNFGNQNNSNNNYYNNNGAGMNNGNNNNNGNNRRFQNNNNMNHNQQGQFT
NGGNKFNKGHGNNNGMSNKKQNQWNGQQNNQIPSQDNQTGISSDGYYEGSSSQIGQQYDV
SQMYNYQQSQQGSHYMMQDQSNPYQ


>TTHERM_00484731(coding)
TTTTTCAGAATATTATAATTGAAATTTTACAGATTAAAATTAGTTAAAAAAATAAAGTAA
ATTCTGAAAGCAAAAATGAGTTTTCAAAATCAAGAAATTCACGATGACTTGAATGAAATG
TAAAAGCTAACTGAAGCATAGGAAGAACAATTCAAGCAACAAAATGACAATGACTATGAT
TAAGTAGGAACAAGTGGTTATTAAGAAATAATCAAAAGATCAAGAGAAAATTCGATAGAT
TCAGCCCGTTCGCGCTCAAGATCAATCAATGAAAGAAAGAGAAATTATAACAGATAGCAA
AATAGCAACGAAGAAGAGAGTCCAAGTAATATAAATCAAAATAGCAGGCCTGTTGCTTAG
AGAAGCAATCATTTCTTTGAGTAAAATGATGAATAGAATGAATAAAATTTAGGAGAAAAT
GATTTGAATAGTAACAACACAACTGGAGTTGATTTTAGTAAAATGAATTTCAACTAAAGT
TTGTAATAACTTTAAGAGATGGTCAATAAAGTAGAAGTACCTGTGATTAAGTTAGATAAC
TAATCAGGATATCGTCACGCTAGACGTCTTTATATTGGTAACATTCCTGAAACTATTAAT
TAAGAATATCTAAGTGAATGGCTTTATCGTTCTCTTGAAGCAGCTGGAGGTCTTTAGCCT
TCTTTGCCCTCAGAAAATCCAATAGTAAAATGTGAAATTGATCCTAAAGGAAGGTTTGCA
TTTACTGAGTTAAGGTCAATTGAAGAAACCACTGCTTTGCTTCAATTAGATGGAATTATT
TTGTGGCACAGATAATTAAGAATAAGAAGACCTACTGAATATGAAAAGTTCCCTAAGGTT
CAAGGACAATTTGAAGCTAATATTCCCAAATTGAATTTCGATCTTTTCAAAACTGTTGGA
ATAGTAATTATTCCTACTATTGTTGATGATGGTCCTAACAAGATATTCTTGGCTAACTTG
CCCACTAAGATGGATGAGTTAATGATTTTAGATGAATTAAAACTTAGAGATATGGGTGAA
ATTAAAGCATTCCATTTAGTTAAAGATAATCAAACTAACTAAAGTAAGGGATATGCCTTT
TTTGAATTCAAAGATCCTTCTCTTACTGATAATTGTATAGAGACATTACATGGTATGCAA
TATGCTGGTAGAACTCTTACATGCAAGAGATCTTAAATAGGAGGCTTAGGCAATAAATAA
ATGTCAACAGGAAACAATAAATAAAACAATAATAGAAATAGCAATCAGTAAAATAACTTA
GGTGGTAATAATAACATGCAAAGATAGAGTTTCTCTTCAGAAAATATTGATTCTATATAG
GGATAAAACTAATAAGGTATCAATGAAGGCAGTGGATTCTTTCCCAATTACTAATCAAAC
ACACAAGGTGGTGGAAATAACTAAAACAAGGGTATGAACTAAAATTATCAAAATAATGGC
AATAATCATAACAACAATAATAAAAGAGGAAGAAACTTTGGAAATTAAAATAACTCAAAT
AACAATTACTACAATAATAATGGGGCAGGAATGAATAATGGTAATAACAATAATAATGGA
AACAATAGAAGATTCTAAAATAACAACAATATGAATCACAATTAGTAAGGTTAGTTTACA
AACGGAGGAAATAAATTCAATAAAGGGCATGGTAACAACAACGGAATGAGTAACAAGAAG
TAAAATTAATGGAACGGTTAGCAAAATAATTAAATCCCAAGCTAAGATAATTAAACTGGT
ATCTCCTCTGATGGATATTATGAAGGAAGTAGTAGCTAAATTGGCTAATAATATGATGTT
AGCTAAATGTACAACTATCAATAATCATAACAAGGATCTCATTATATGATGCAAGACTAA
TCTAATCCTTATTAATGA


>TTHERM_00484731(gene)
GTTTTTTCAGAATATTATAATTGAAATTTTACAGATTAAAATTAGTTAAAAAAATAAAGT
AAATTCTGAAAGCAAAAATGAGTTTTCAAAATCAAGAAATTCACGATGACTTGAATGAAA
TGTAAAAGCTAACTGAAGCATAGGAAGAACAATTCAAGCAACAAAATGACAATGACTATG
ATTAAGTAGGAACAAGTGGTTATTAAGAAATAATCAAAAGATCAAGAGAAAATTCGATAG
ATTCAGCCCGTTCGCGCTCAAGATCAATCAATGAAAGAAAGAGAAATTATAACAGATAGC
AAAATAGCAACGAAGAAGAGAGTCCAAGTAATATAAATCAAAATAGCAGGCCTGTTGCTT
AGAGAAGCAATCATTTCTTTGAGTAAAATGATGAATAGAATGAATAAAATTTAGGAGAAA
ATGATTTGAATAGTAACAACACAACTGGAGTTGATTTTAGTAAAATGAATTTCAACTAAA
GTTTGTAATAACTTTAAGAGATGGTCAATAAAGTAGAAGTACCTGTGATTAAGTTAGATA
ACTAATCAGGATATCGTCACGCTAGGTATAATTTCATAGATTAATAAATTTACTAAATAA
CCACGGTATTTTCCTTCCTGATTAATAAAAGCAGCTTTAATAACATAGCTCTGCTTTAAT
TGCATTAAGTAATGCTATTTTGCAGAAACATGTTGTTTTAAAGAGCATACTTTTGAAGCT
GAAAGAAGAAAAAAAACTAAATAAATAACTTCGCCATAATATCAAAAGCAAACAAGCAAG
AAAAAAAAACAAACAAACAAACAAACCTAATTTTCTTCCCCACTCTTTTTCAAATTTTTT
CTCTTTACCATTTTTGTAGCAATAAAAAAATCATCTTATTTTCTGTTTCTTTGATTTTTT
ATCATTGACCACCCCTCACAAATAATTTACAAAAAACTTTCTAATCCCCCTCCTTTCAAT
ATTTTGCTTTGTATTATAAAGCAAAATCTATTTATCTATCTATCTAATCTTATCTCTCAT
TCATTCATTTATTCAATCTTTCTTCATTGATTCTTATTTTTTTTCTTTCTAATTTACCAT
GAATACATACTTATATTATATGTATATAATATTTTATAATCATATTATAATTAGCACCAT
ACTTTATCATCAATAGCAATTATTAAAAAATAAATCTTAATTTCTTTTCCTTCTTTTTCA
ATCAAATAAAGAATTTAAAATTATTTTTTTCCCCCTCTTTTCTTCAATCTTTTTTTATTT
ATGACTGACCAAAAATTAATTTTAAAAACTATATGCTACCTGTTTTTTCAAATATCTTCT
TTTTCATTCTTTTTAATAGAAAAAGTCAACAAAAGAGAATTACATGATATTATACATTTA
TGAATCATCAAATATTTTGTAGTATTTACTGCTTTCTCTCTTCTTTCTTCTTTTATTTTT
TGCTTCTGCTCTAAATATTCATTCATTCATTTATTATTATTCTTCATATGTTATTTAATT
TTACTTAAAATTGTTCATTTAAAATCATTTTAGTAGAAAAAGTATCTCTCCTTTACGTAC
CATTTAATTTTTTTAAAATTAGAAAGAAAACAAATAAACAAACATTCATATAAATAAACT
AACTATTTACAGGATTGATTTAGGGTTGAAACAAATAAAAATAAACAAATAATAATGTAT
TATAAGTTGAGGGAAAGATCCGTATCACCTTCAAAGATATTTAAATAAAAAAAATCTTCT
CATACAGTTTTAATATGATTCGATATCAATAGCTTTTTAATATTGCTATTTCGTGATATT
TTTGAATTTAAATCAGGAAAATATGCCGCTAATTTTAATATTTTTGAAATTTCATGAATT
AATTAATTTAATTATAGACGTCTTTATATTGGTAACATTCCTGAAACTATTAATTAAGAA
TATCTAAGTGAATGGCTTTATCGTTCTCTTGAAGCAGCTGGAGGTCTTTAGCCTTCTTTG
CCCTCAGAAAATCCAGTAAAAAATTTTATTAATAAATATTTCTAAAATTAAAAATATTAT
TTTTAACTTTATAAAAGATAGTAAAATGTGAAATTGATCCTAAAGGAAGGTTTGCATTTA
CTGAGTTAAGGTCAATTGAAGAAACCACTGCTTTGCTTCAATTAGATGGAATTATTTTGG
TAATAAAATAAACAATAAAACATTTTATAATTTTAATTAATTAATTAATTAAAAAATTAG
TGGCACAGATAATTAAGAATAAGAAGACCTACTGAATATGAAAAGTTCCCTAAGGTTCAA
GGACAATTTGAAGCTAATGTAATTAATTAATTTCAATTATTTTAATTATTTAATTTTACT
TATTTAAAATAGATTCCCAAATTGAATTTCGATCTTTTCAAAACTGTTGGAATAGTAATT
ATTCCTACTATTGTTGATGATGGTCCTAACAAGATATTCTTGGCTAACTTGCCCACTAAG
ATGGATGAGTTAATGATTTTAGATGAATTAAAACTTAGAGATATGGGGTAATAATTTACT
TTTGATTATATATTTTAAAACTTGTTAATTCATATTTTTTTGATTAAAACAGTGAAATTA
AAGCATTCCATTTAGTTAAAGATAATCAAACTAACTAAAGTAAGGGATATGCCTTTTTTG
AATTCAAAGATCCTTCTCTTACTGATAATTGTATAGAGACATTACATGGTATGCAATATG
CTGGTAGAACTCTTACATGCAAGAGATCTTAAATAGGAGGCTTAGGCAATAAATAAATGT
CAACAGGAAACAATAAATAAAACAATAATAGAAATAGCAATCAGTAAAATAACTTAGGTG
GTAATAATAACATGCAAAGATAGAGTTTCTCTTCAGAAAATATTGATTCTATATAGGGAT
AAAACTAATAAGGTATCAATGAAGGCAGTGGATTCTTTCCCAATTACTAATCAAACACAC
AAGGTGGTGGAAATAACTAAAACAAGGGTATGAACTAAAATTATCAAAATAATGGCAATA
ATCATAACAACAATAATAAAAGAGGAAGAAACTTTGGAAATTAAAATAACTCAAATAACA
ATTACTACAATAATAATGGGGCAGGAATGAATAATGGTAATAACAATAATAATGGAAACA
ATAGAAGATTCTAAAATAACAACAATATGAATCACAATTAGTAAGGTTAGTTTACAAACG
GAGGAAATAAATTCAATAAAGGGCATGGTAACAACAACGGAATGAGTAACAAGAAGTAAA
ATTAATGGAACGGTTAGCAAAATAATTAAATCCCAAGCTAAGATAATTAAACTGGTATCT
CCTCTGATGGATATTATGAAGGAAGTAGTAGCTAAATTGGCTAATAATATGATGTTAGCT
AAATGTACAACTATCAATAATCATAACAAGGATCTCATTATATGATGCAAGACTAATCTA
ATCCTTATTAATGAAATAAAAATTCCAACAATTTTAAAAGCTAATATTTAATTATTTTTA
ATTTTAAATTTACAAGAATTCTTGTATTTCCTTTTACATAAAAATTAATTATGTTTGTAT
GTTTGTACAGACTTTAAATAAGTAATAAATT