Identifiers and Description

Gene Model Identifier

TTHERM_00474850

Standard Name

RRM27 (RNA Recognition Motif-containing protein 27)

Aliases

PreTt02284 | 57.m00223 | 3709.m00083

Description

RRM27 hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00474850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13160.19.997093137033517e-262hypothetical protein (590 aa)
OxytrichaContig16218.0.g1010.0000009995106777214876RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00474850(coding)
ATGGATAAAGGGAGGTATAACTAACTAATTAATATTAAATTTTTTGGAAATTAATATGGA
AGAAGTAATGGTAGTTAAGGCTATGACAAATCTTATTACTAGCTTAATGATTATGGAAGT
TAGAGATATTATTATAAAAACAGAGGATATCGTGTTGATGGAGGTAGAGGAAGCTCTCCT
TATAAATATAGAAATTATTCAGAAAATGCAGATTTTGATTAAAAAGATGAGTAGTTTACA
AACGATCCTAGAGTTTTTTTTGCTTAAAAACCATCTGAAGATATAGAAAAAGATATGAAT
AGCATGATTTAGTACTACTAGAATAAGTACAGAAAATTATTTGATAGAGAATAATTAAAG
AGAGGTATTGAAGAGGACATATATAAAGTGAATCCATAGTTGGAGCATTATGATATGAAT
AGGTTAATTAAGATAAGGTTAGTTTTTGAAGATAAATAAACTGATAAGGTATACACATAA
AAGAACGAGGATTTATTTTAATTCGATGAAGCAGACCTAAAGAGATTCTTCCATGTATTT
GGAAAGATAGAGAAAATTGTAATTAAAGATAAATGTGTAAGCTACATTTTCTTTTAGGAT
TTAATATCAGCATTTTGTGCCTAAAGGGCGATGAACAATTTCGTTTTAGAAGATATTAAT
GCTAGGTTAGAAATTCAACTTTGTGTTGAGGATCCTGACGAATAAAATGAAAATAAGTTA
ATTGGCCATTTCATGCATGAAACAATAAAAGATGAAGTTTACTTGATTCGGATTTCGACT
TTAGAAGATGATAGATAGATGAAGTAACTAGTAAGCAAATATAAATATACCAGTATGTTT
ACAATGGAAATAAATGATCCAGAATTTCATTTAAAAGAAAGAATTATGGGAGCTTCGGCA
TCTAATTTTTTTAGGTTGTTTTATTTATGTGAGAAGAATTCTGTTGAAATTGGAAACGGT
AAATAAAATTCACAAACTGGTGGAAGTGAAGATTTGGTTATTTCATTAAATCAAGCCAAA
GAAATAAGAAGTCAACAACAGAATAACAATATTAGTAAAACAAGCAATGGAAACAACAGC
AATGTAGGAAGTAGCACGAATTTGAGCACAAATTAGCCAAATACAGCAAATACAAATAAA
CCTATTATAGCTAATAGTAATAATTCAAATAATAATAGCAACGCGGTTAGTGTAAACAAC
TAAAATAGTGGAAATAATATTAGTAATAGTAGTGGTAATAACAATAACAATTCATCCTAT
AGTACTTCTGAAGAAATTACTTTCAGAATGATTGTTAATGATATGAAATAAACATAAAAT
GAAGTACTTATTCTCTCAAATAATTTAGAAAAATATAACACAGCCATAAGATACATGCAC
GAGCTTCTGGCTTAGGTAAACGAAGAATACAGGCGCTTTTGCGAGTTCTAAAAGAAAATA
AATCCTGGCCCTTTACATATAAAGCGTATTGAAAAATTTAACTTAGATCCTGAATTAACA
TTTATTTCTACTAAAGATTTGTTGAATAAAAGCTTAGCTGGAAAAGAAAATAATATATAA
AAAGGAGATGGATCCGATAAAATCAGCATCGGCTCCACCTCTTTGTAATTTGTAAACAAC
AGTAATAATATTAATAATAATAATAATAATAATTAGTCTATGTAAATAGAATACTCCTCT
TTCAGCAATTAGACTGGAGTAGGAGGTTCATAAGATTTTTAATAAAAGTTATTATCTTGA


>TTHERM_00474850(protein)
MDKGRYNQLINIKFFGNQYGRSNGSQGYDKSYYQLNDYGSQRYYYKNRGYRVDGGRGSSP
YKYRNYSENADFDQKDEQFTNDPRVFFAQKPSEDIEKDMNSMIQYYQNKYRKLFDREQLK
RGIEEDIYKVNPQLEHYDMNRLIKIRLVFEDKQTDKVYTQKNEDLFQFDEADLKRFFHVF
GKIEKIVIKDKCVSYIFFQDLISAFCAQRAMNNFVLEDINARLEIQLCVEDPDEQNENKL
IGHFMHETIKDEVYLIRISTLEDDRQMKQLVSKYKYTSMFTMEINDPEFHLKERIMGASA
SNFFRLFYLCEKNSVEIGNGKQNSQTGGSEDLVISLNQAKEIRSQQQNNNISKTSNGNNS
NVGSSTNLSTNQPNTANTNKPIIANSNNSNNNSNAVSVNNQNSGNNISNSSGNNNNNSSY
STSEEITFRMIVNDMKQTQNEVLILSNNLEKYNTAIRYMHELLAQVNEEYRRFCEFQKKI
NPGPLHIKRIEKFNLDPELTFISTKDLLNKSLAGKENNIQKGDGSDKISIGSTSLQFVNN
SNNINNNNNNNQSMQIEYSSFSNQTGVGGSQDFQQKLLS


>TTHERM_00474850(gene)
ATGGATAAAGGGAGGTATAACTAACTAATTAATATTAAATTTTTTGGAAATGTAAAAGTT
GAGCAGAAATTATAAAGAAGTGCGCAAAGAATCTATCTAGTTTAATTTTTAAAAATAAAT
ATAAGGACGACTTTAAAAATATTCAGGACATATATGAAATCCTATAGAGATGAATGATGA
AGAAAAACGACTTATATATAAATTTTTACACCTTTTTTTTGGAATTTAATACTAAATTAA
ATTCAATAACATAAATTAAATAATTTTGTGAGATCTTTAGATAAATATTAAGTCATAAAT
AAAGTGAATTTCGCTCAAAAATATTTTATTTCATAGTAATTATAAAAATTTTCGTATCAT
ATAACTGTAGAAGAGCTACTATTTTCATTATGAGTCATTTCATGTAAAATTTGATGCTTT
CATTCTAAATTAAGATTAGTTGCTAATAACTATATTTTATTATTTAAAAATAGCCGAAAG
TAGGTAATTAGAAAAATACATATAAAAAGCAATGTTATCATTTTTATCCACAAAATTGAT
TTCAAAAATGTTTTTAGACAAAGCTATTATTGGTTAGATCCTTTTACACTTTAAAAAGAT
ATTGTTTTTTTAACATTTTCAAATATTTTAAAATATTTGAGGATATTAATCAATTTAATG
TAATTATAGTAATATGGAAGAAGTAATGGTAGTTAAGGCTATGACAAATCTTATTACTAG
CTTAATGGTAAATAAAATAATTATTAGATATTTTAAAAGTGATTGCCTTTCATGCTTTTT
AAATATTTTTATTCCATTTTGAGAAAACTTTGTATTAATATGCATTTTTCAAAATAAAAT
TAATCAATAGTTACAGAAGATAGTTTATTTTATCAATTTTATAAATAGATTATGGAAGTT
AGAGATATTATTATAAAAACAGAGGATATCGTGTTGATGGAGGTAGAGGAAGCTCTCCTT
ATAAATATAGAAATTATTCAGAAAATGCAGATTTTGATTAAAAAGATGAGTAGTTTACAA
ACGATCCTAGAGTTTTTTTTGCTTAAAAACCATCTGAAGATATAGAAAAAGATATGAATA
GCATGATTTAGTACTACTAGAATAAGTACAGAAAATTATTTGATAGAGAATAATTAAAGA
GAGGTATTGAAGAGGACATATATAAAGTGGTAATAATAAATTTAGTTTTAAAAAATAATT
TAAACAATAACTTAAATAACCCAGCTAATTAGCTTATACCTTCCATATGACAATCTTTAA
AAAAAAGAAATAATATTTGTGTCTACTAAGTGGTATTTTTCAAATTAACCTAGTTAAAAT
TATGACTATTAGATAATTATTTTAATATTTTATTGAGAAAATTATTTTACAATAAATAAT
AGAATCCATAGTTGGAGCATTATGATATGAATAGGTTAATTAAGATAAGGTTAGTTTTTG
AAGATAAATAAACTGATAAGGTATACACATAAAAGAACGAGGATTTATTTTAATTCGATG
AAGCAGACCTAAAGAGATTCTTCCATGTATTTGGAAAGATAGAGAAAATTGTAATTAAAG
ATAAATGTGTAAGCTACATTTTCTTTTAGGATTTAATATCAGCATTTTGTGCCTAAAGGG
CGATGAACAATTTCGTTTTAGAAGATATTAATGGTATTAATTCATACAATTTAACTTTTT
CAAGTTAGTTTATTGCTTCTTCTTCCTTAAATAAAATTGATATTAAAATTCAAACATGAA
CATTTTAAAAAGCTAGGTTAGAAATTCAACTTTGTGTTGAGGATCCTGACGAATAAAATG
AAAATAAGTTAATTGGCCATTTCATGCATGAAACAATAAAAGATGAAGTTTACTTGATTC
GGATTTCGACTTTAGAAGTTAGTCATTTTTTAATTATTTCTATTACTTATTATAAAAATA
GACATTCAAAAAGACAGAAAAATATGCATATTCAAATCATTAAATTAATTTTTATAAATA
GGATGATAGATAGATGAAGTAACTAGTAAGCAAATATAAATATACCAGTATGTTTACAAT
GGAAATAAATGATCCAGAATTTCATTTAAAAGAAAGAATTATGGGAGCTTCGGTAATAAT
TTTATTTTAGGGTTATTTAGATTTTTAGAAATAATAGTTGATTATAAATCTTTGAATAAT
TAAATAAATAAATAATTTACTTTTTTTTATTTTTATTTGATAACTAAATATCAAATTAAA
TTATGCGATAAATAATTTATTTATTTAAACTATTAAAAATCAATTAAAATTTATCAAATT
TTAGACAAAATAAATTAATTACTAAAAAAGAGGTAGAAAGAACTAGAATTTGCAATTAAT
TTTAATCAACTTTCTTACTTAAGCAAATAAAGATTAATTGATTCTTCTATTTATTTATTT
TATTTTCTTGTCAAGTTTTAAAAAAATATTTTGTATGACATGCAATTCAGACATATAATT
ATTATTTTAAACGATTTTCTGTTTAATAAAATAAATTTTTTTAAAAATATAGGCATCTAA
TTTTTTTAGGTTGTTTTATTTATGTGAGAAGAATTCTGTTGAAATTGGAAACGGTAAATA
AAATTCACAAACTGGTGGAAGTGAAGATTTGGTTATTTCATTAAATCAAGCCAAAGAAAT
AAGAAGTCAACAACAGAATAACAATATTAGTAAAACAAGCAATGGAAACAACAGCAATGT
AGGAAGTAGCACGAATTTGAGCACAAATTAGCCAAATACAGCAAATACAAATAAACCTAT
TATAGCTAATAGTAATAATTCAAATAATAATAGCAACGCGGTTAGTGTAAACAACTAAAA
TAGTGGAAATAATATTAGTAATAGTAGTGGTAATAACAATAACAATTCATCCTATAGTAC
TTCTGAAGAAATTACTTTCAGAATGATTGTTAATGATATGAAATAAACATAAAATGAAGT
ACTTATTCTCTCAAATAATTTAGAAAAATATAACACAGCCATAAGATACATGCACGAGCT
TCTGGCTTAGGTAAACGAAGAATACAGGCGCTTTTGCGAGTTCTAAAAGAAAATAAATCC
TGGCCCTTTACATATAAAGCGTATTGAAAAATTTAACTTAGATCCTGAATTAACATTTAT
TTCTACTAAAGATTTGTTGAATAAAAGCTTAGCTGGAAAAGAAAATAATATATAAAAAGG
AGATGGATCCGATAAAATCAGCATCGGCTCCACCTCTTTGTAATTTGTAAACAACAGTAA
TAATATTAATAATAATAATAATAATAATTAGTCTATGTAAATAGAATACTCCTCTTTCAG
CAATTAGACTGGAGTAGGAGGTTCATAAGATTTTTAATAAAAGTTATTATCTTGA