Identifiers and Description

Gene Model Identifier

TTHERM_00456820

Standard Name

RRM26 (RNA recognition motif-containing protein 26)

Aliases

PreTt20312 | 53.m00214 | 3712.m00074

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01649 ) hnRNP-L/PTB/hephaestus splicing factor family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00456820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13774.19.997093137033517e-262hypothetical protein (862 aa)
WormBaseWBGene000042070.00000000002000577768187062locus:ptb-1 status:Confirmed
UniProt:Q8T3E6 protein_id
:CAD30435.1
SGDYER165W0.00006000996057121373PAB1 Poly(A) binding protein,
part of the 3-end RNA-processi
ng complex, mediates interacti
ons between the 5 cap structur
e and the 3 mRNA poly(A) tail,
involved in control of poly(A
) tail length, interacts with
translation factor eIF-4G

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00456820(coding)
ATGGCTAATAATTCCTCTTCTAAATTTGTTTATGTAGAAAGTGATATTGTAACTCCTGAC
TATAGTGGCAGAAGAAGCTAAAAGACTACAATATCCGATGTTTCAGTAAAAAAGAGAGTT
TTACTCGTTTGCGTTTACAATAAAAAGGGCACTCTCATAACTCATGATATTATTTATAGG
CTTTTCATGAAATACGGAGAGATATATAAAATCCTTATTTTTGATAAATGTAAAAATTGG
AAAATTTTTGTAGAAATGGCCACCCTTGAATAAGCAGAGAAAGCTAGAGATGGTCTTAAC
AACTATTAATTATTTGACGATGGCTCAAAGATGACAGTTTATTATGCTAAAGTTGATCAA
ATTGTATTTTAAAATAATAATTCTGGCGGAGTTGACTATCGTGAGTTAAAACAAAGAAAA
GTTAATTAAATAAGTAACTTTTAATCAAACGGAGTCATAAATTCTGCCTCTAATTTGTCA
AAGTAAGTATTAGGAGGTAGTCCCAACTTTAATCCTCTCTCTGCAGATTAGTTAGCCAAA
AAAGCCATTAATTTGAATGGTTCTTAGAGAAATTCTATTTTAAATGGTCTTGGTGATAAC
CATAATTCTATAGAAAAACACCGTAATAACTCGTTTGACTATAGTGAGCTATATAGAAAA
TTTGAAAGTGTACCAAATACAAGAGTATCACCTTAACATGGCAGCATTATAGGAGGAAAA
AAGAATTCTCTATTTTAGAATATATAGCCAATATAGATTACCCAAGAAAACAAAAACGTT
TAAGTAGAGGTTATGAACGACCCTAATATGCAAAACTCAAACAATGATCTTTCAAATTAT
GAGTTTGATGATGCAAACATGAATTAAATCTAGTAAAATATCTAAAAGATAGATATAAGC
AATAGCTAGGATTAATTAGATATAGGTAGTTCAAGAATTGATAACAACAGTCCCTAAAGT
GAAAAAGATGTTGATAAGTAAAACTAAAATGGTCCCTTAAATTTTAAGAGTAGCAATGAC
TACAAATCTGGCAGCAATACCGCAGTTGTAAGTAGCAATAATTTTAACAATGAATGTGGA
AGTAATCATCTCATCCTACCTTTTGGAAATCAACCTAATTAAAATTATACAAACAATAAC
GAGATAGGCAGCTTTTCTTCTACAAGTAACAACAACCCTGAAAATCTAATTGGAAACACT
TAACTTGGCTTATTCAACAAAGGTTATAAGTTGGAAGACGAAGATGATTACGAAGCCTAA
GAGGATGATTAAAAATCAGATGGAGAATAAATCCATCCAGATAGGATCAAAAATGGCGAA
GGGATCGAAAATGTTGGAGGAACGATCTCAAATGATATAGATCCTAGTAGATATATAAAT
CCTTTATATATACTAGAAAATAAAAAATCTAGAGTAATCTATGTCCGTGGTTTAGAGAAA
AAGAATCTAACTACTAAAAAGATATATAATCTCTTCAGTAATTTTGGTAATATTGAATTA
ATTCTATATTTTACTGAAAAGAAGTATTGTTTGATTCAATTCGAAACCCAAGAAGATGCA
ACAATTGCAAAAGAGCATTTGGATAACTTGAAGGTGGAATCTAATTAAATGAGAATTTTT
TACTCAAACTATGAGACTATCAAAGAAAATCAAGAGGGTGAAAAGTAATGCGAAGTATGG
AAAGGTGAGAAAAGCAGCTTCCGCTTCCGTTATGGCAAACAAATATCAATTAATCCTGTT
ACCAACACACTCCATGTGTCCAACTTGAAGTAGGATACCTGTAAGCAAGAAGTTATCAAT
GAAAAGTTTTCTTTATATGGGTAAATAGAAGGCTTCCATCCAATTCAAAATTAAAATAAA
TATATGTGTCATGTTAAATTCTCCACCTCAGAAGAAGCTATAAATGCTCTTTGTAATCTT
CATGAAGAAGAGATTCTTGGTCGTAAGATGCACATTTCTTTCACAAGAGCTAGAATTTCT
CCTTAATAAACACCTGATGGACCTCTTGCATCTAATAATAGTAATAACAATAATATCAGC
AACAATAACAATAATATCAATAACATCAATTATTCTAACTATAGAAGAAACTCTAACTAA
AATAATATCAATATGAATAATCCTAATGGAAACTAAAATTTAAATTCTTCCCCTTAAATT
TTGAAAAATGGTAATCTTCGAAAAAACTCTATTTAAATGAACAATCTTCAAAAGAACATT
ACTAACAATGATCCTATTAATGATGTAAAGCAAACTTTAAAAATCTTAAATGATGATGAG
GACTATAAAAATAACCATTAGCAAGTAGTCTACCCCTACTAAGCCCATTCTGTTTTATTG
CAATAACCACAATATTATTAATAACCGATCACATACATTCAAACTGCTCCTATTGTTTTC
TAAGGTTTAAATCAAATGCATCCAAACTAATAAAATTAATTAGGTTATTACGCTTCATAT
CCTCATTAACAATAACATATGAACAATCCTATTAATATGCAAAGTAAAAACTTTACTTTA
TTTAAGTGA


>TTHERM_00456820(protein)
MANNSSSKFVYVESDIVTPDYSGRRSQKTTISDVSVKKRVLLVCVYNKKGTLITHDIIYR
LFMKYGEIYKILIFDKCKNWKIFVEMATLEQAEKARDGLNNYQLFDDGSKMTVYYAKVDQ
IVFQNNNSGGVDYRELKQRKVNQISNFQSNGVINSASNLSKQVLGGSPNFNPLSADQLAK
KAINLNGSQRNSILNGLGDNHNSIEKHRNNSFDYSELYRKFESVPNTRVSPQHGSIIGGK
KNSLFQNIQPIQITQENKNVQVEVMNDPNMQNSNNDLSNYEFDDANMNQIQQNIQKIDIS
NSQDQLDIGSSRIDNNSPQSEKDVDKQNQNGPLNFKSSNDYKSGSNTAVVSSNNFNNECG
SNHLILPFGNQPNQNYTNNNEIGSFSSTSNNNPENLIGNTQLGLFNKGYKLEDEDDYEAQ
EDDQKSDGEQIHPDRIKNGEGIENVGGTISNDIDPSRYINPLYILENKKSRVIYVRGLEK
KNLTTKKIYNLFSNFGNIELILYFTEKKYCLIQFETQEDATIAKEHLDNLKVESNQMRIF
YSNYETIKENQEGEKQCEVWKGEKSSFRFRYGKQISINPVTNTLHVSNLKQDTCKQEVIN
EKFSLYGQIEGFHPIQNQNKYMCHVKFSTSEEAINALCNLHEEEILGRKMHISFTRARIS
PQQTPDGPLASNNSNNNNISNNNNNINNINYSNYRRNSNQNNINMNNPNGNQNLNSSPQI
LKNGNLRKNSIQMNNLQKNITNNDPINDVKQTLKILNDDEDYKNNHQQVVYPYQAHSVLL
QQPQYYQQPITYIQTAPIVFQGLNQMHPNQQNQLGYYASYPHQQQHMNNPINMQSKNFTL
FK


>TTHERM_00456820(gene)
ATGGCTAATAATTCCTCTTCTAAATTTGTTTATGTAGAAAGTGATATTGTAACTCCTGAC
TATAGTGGCAGAAGAAGCTAAAAGACTACAATATCCGATGTTTCAGTAAAAAAGAGAGTT
TTACTCGTTTGCGTTTACAATAAAAAGGGCACTCTCATAACTCATGATATTATTTATAGG
CTTTTCATGAAATACGGAGAGATATATAAAATCCTTATTTTTGATAAATGTAAAAATTGG
AAAATTTTTGTAGAAATGGCCACCCTTGAATAAGCAGAGAAAGCTAGAGATGGTCTTAAC
AACTATTAATTATTTGACGATGGCTCAAAGATGACAGTTTATTATGCTAAAGTTGATCAA
ATTGTATTTTAAAATAATAATTCTGGCGGAGTTGACTATCGTGAGTTAAAACAAAGAAAA
GTTAATTAAATAAGTAACTTTTAATCAAACGGAGTCATAAATTCTGCCTCTAATTTGTCA
AAGTAAGTATTAGGAGGTAGTCCCAACTTTAATCCTCTCTCTGCAGATTAGTTAGCCAAA
AAAGCCATTAATTTGAATGGTTCTTAGAGAAATTCTATTTTAAATGGTCTTGGTGATAAC
CATAATTCTATAGAAAAACACCGTAATAACTCGTTTGACTATAGTGAGCTATATAGAAAA
TTTGAAAGTGTACCAAATACAAGAGTATCACCTTAACATGGCAGCATTATAGGAGGAAAA
AAGAATTCTCTATTTTAGAATATATAGCCAATATAGATTACCCAAGAAAACAAAAACGTT
TAAGTAGAGGTTATGAACGACCCTAATATGCAAAACTCAAACAATGATCTTTCAAATTAT
GAGTTTGATGATGCAAACATGAATTAAATCTAGTAAAATATCTAAAAGATAGATATAAGC
AATAGCTAGGATTAATTAGATATAGGTAGTTCAAGAATTGATAACAACAGTCCCTAAAGT
GAAAAAGATGTTGATAAGTAAAACTAAAATGGTCCCTTAAATTTTAAGAGTAGCAATGAC
TACAAATCTGGCAGCAATACCGCAGTTGTAAGTAGCAATAATTTTAACAATGAATGTGGA
AGTAATCATCTCATCCTACCTTTTGGAAATCAACCTAATTAAAATTATACAAACAATAAC
GAGATAGGCAGCTTTTCTTCTACAAGTAACAACAACCCTGAAAATCTAATTGGAAACACT
TAACTTGGCTTATTCAACAAAGGTTATAAGTTGGAAGACGAAGATGATTACGAAGCCTAA
GAGGATGATTAAAAATCAGATGGAGAATAAATCCATCCAGATAGGATCAAAAATGGCGAA
GGGATCGAAAATGTTGGAGGAACGATCTCAAATGATATAGATCCTAGTAGATATATAAAT
CCTTTATATATACTAGAAAATAAAAAATCTAGAGTAATCTATGTCCGTGGTTTAGAGAAA
AAGAATCTAACTACTAAAAAGATATATAATCTCTTCAGTAATTTTGGTAATATTGAATTA
ATTCTATATTTTACTGAAAAGAAGTATTGTTTGATTCAATTCGAAACCCAAGAAGATGCA
ACAATTGCAAAAGAGCATTTGGATAACTTGAAGGTGGAATCTAATTAAATGAGAATTTTT
TACTCAAACTATGAGACTATCAAAGAAAATCAAGAGGGTGAAAAGTAATGCGAAGTATGG
AAAGGTGAGAAAAGCAGCTTCCGCTTCCGTTATGGCAAACAAATATCAATTAATCCTGTT
ACCAACACACTCCATGTGTCCAACTTGAAGTAGGATACCTGTAAGCAAGAAGTTATCAAT
GAAAAGTTTTCTTTATATGGGTAAATAGAAGGCTTCCATCCAATTCAAAATTAAAATAAA
TATATGTGTCATGTTAAATTCTCCACCTCAGAAGAAGCTATAAATGCTCTTTGTAATCTT
CATGAAGAAGAGATTCTTGGTCGTAAGATGCACATTTCTTTCACAAGAGCTAGAATTTCT
CCTTAATAAACACCTGATGGACCTCTTGCATCTAATAATAGTAATAACAATAATATCAGC
AACAATAACAATAATATCAATAACATCAATTATTCTAACTATAGAAGAAACTCTAACTAA
AATAATATCAATATGAATAATCCTAATGGAAACTAAAATTTAAATTCTTCCCCTTAAATT
TTGAAAAATGGTAATCTTCGAAAAAACTCTATTTAAATGAACAATCTTCAAAAGAACATT
ACTAACAATGATCCTATTAATGATGTAAAGCAAACTTTAAAAATCTTAAATGATGATGAG
GACTATAAAAATAACCATTAGCAAGTAGTCTACCCCTACTAAGCCCATTCTGTTTTATTG
CAATAACCACAATATTATTAATAACCGATCACATACATTCAAACTGCTCCTATTGTTTTC
TAAGGTTTAAATCAAATGCATCCAAACTAATAAAATTAATTAGGTTATTACGCTTCATAT
CCTCATTAACAATAACATATGAACAATCCTATTAATATGCAAAGTAAAAACTTTACTTTA
TTTAAGTGA