Identifiers and Description

Gene Model Identifier

TTHERM_00446190

Standard Name

RRM25 (RNA Recognition Motif-containing protein 25)

Aliases

PreTt03886 | 51.m00252 | 3704.m00107

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00446190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10831.14.000010081770683e-74hypothetical protein (298 aa)
WormBaseWBGene000047000.00000000000020009182674645818locus:rsp-3 Probable splicin
g factor, arginine/serine-rich
3 status:Confirmed UniPro
t:Q9NEW6 protein_id:CAC35847
.2
OxytrichaContig6339.0.g1050.0000000000019997478866288316RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02803930.0000000029989608248573072DDB_G0280393 on chromosome: 3
position 3254509 to 3256772
SGDYIR001C0.0000000039998859049333245SGN1 Cytoplasmic RNA-binding p
rotein, contains an RNA recogn
ition motif (RRM); may have a
role in mRNA translation, as s
uggested by genetic interactio
ns with genes encoding protein
s involved in translational in
itiation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00446190(coding)
ATGGATTAATAGAGATTGAATTTAAGAAGAAATATTCAATTTATTTTGAAATAAAAATAT
AAATATAAATTAATATTTTAAAGAAAGAATAAAAAAAGAAATATGAGCAGAGAACATTCA
AGAGACAGAGACAGTAAAAGCCAAAAGAAATTATTCTTGGGTAACCTCTCTAGAGATGTT
GAAGAAAGAGATGTTAAAGATCTTTTCGAAAAGCATGGTAAAATCAGTGAAATCAAGATT
AAAAAGAAAGGTCCTAACTGTTATGGATTTATCGAATTCGAAGATTCCCGTGATGCTAAG
GATGCTCTCAAGGAAAATGGTAATTCATTGAAGGGTAAAGAACTCAGATTAGAATTCGGT
AATGGCGGCAGAAAGAAAAGAAACGAAGGCTGTTATACTTGCGGTTCTCTCCATCATATT
GCTAAAGACTGTAGCAAAACTAGAAGAACTAGCAGCAATGGTAATAAAAATAGATGCTAT
AATTGTGGTTCAACTAGCCATAAGGTCAGAGACTGCCATCAAAATAGAAGAAGCAGATCC
AGAGATAGAAGAAGAAGATCAAGATCTCGTTCTGACTCTAGAAGCAGAAGACAAAGAAGC
AGATCTGACGACAGAAACAGAAGAAGAAGAGACTCTCGCTCTGACTCTAGAAATAGAAGA
AGAAGAAGAGATATGTCTAGATCTAGATCCGCTGGTGACAGAAGAAAGAGAAGTAGTGAT
AGAGGTGATAGAAGAAGACCTAGTCCTGATAATAGAAGAAGAAGATCAAGCTCAAGAGGT
CAAAGAAGATCCGACAGCAGAAGCTATAATAACAGAAATAATAACAGATCTAATTCAGCT
GGTTCTCATAAAAATGATAGATCAGGTAGCAATCTCAACAATGGAAACAATCAACCTGCT
AACAACAATTCTTATAACAATGGTAATAACAACAATTCTCGTTCTCCCTCCAGACAATCT
AACTCAAATTGA


>TTHERM_00446190(protein)
MDQQRLNLRRNIQFILKQKYKYKLIFQRKNKKRNMSREHSRDRDSKSQKKLFLGNLSRDV
EERDVKDLFEKHGKISEIKIKKKGPNCYGFIEFEDSRDAKDALKENGNSLKGKELRLEFG
NGGRKKRNEGCYTCGSLHHIAKDCSKTRRTSSNGNKNRCYNCGSTSHKVRDCHQNRRSRS
RDRRRRSRSRSDSRSRRQRSRSDDRNRRRRDSRSDSRNRRRRRDMSRSRSAGDRRKRSSD
RGDRRRPSPDNRRRRSSSRGQRRSDSRSYNNRNNNRSNSAGSHKNDRSGSNLNNGNNQPA
NNNSYNNGNNNNSRSPSRQSNSN


>TTHERM_00446190(gene)
ATGGATTAATAGAGATTGAATTTAAGAAGAAATATTCAATTTATTTTGAAATAAAAATAT
AAATATAAATTAATATTTTAAAGAAAGAATAAAAAAAGAAATATGAGCAGAGAACATTCA
AGAGACAGAGACAGTAAAAGCCAAAAGAAATTATTCTTGGGTAACCTCTCTAGAGATGTA
AAAGATTTGAATCCACTTATTTAATTTAAAATTAGAAATAAATTCGATATGATCCATATA
TGGTCTGTGATATGTTTTCATTTTTGATGAATGAATAATATAAAAATATCAAATAATCAT
AAAAAATGCTAACTACCTAACCAAACGTTATATATTTTAATTCTAAATAAATATTAAATA
GGTTGAAGAAAGAGATGTTAAAGATCTTTTCGAAAAGCATGGTAAAATCAGTGAAATCAA
GATTAAAAAGAAAGGTCCTAACTGTTATGGATTTATCGAATTCGAAGATTCCCGTGATGC
TAAGGATGCTCTCAAGGAGTAATTTATATTCTTTTATTAAAAATTTCCTTAAGGCATTAT
TTTTATGCTTCTAAATATCATTCGCTGCTATGAAAATTTTTCAAGGAGCAGACAGATGTG
GTGTACTTGAGTTATTCTAGTTAGAATAATTTATTTTAGATGGCTTTTGCTTTACTTAAC
CCCTTTTTTAATTTTAAAAATATTCCATGATGGTAGGTAATAAAAATATTAAAAATTGGT
TTTATAAAATAGAAATGGTAATTCATTGAAGGGTAAAGAACTCAGATTAGAATTCGGTAA
TGGCGGCAGAAAGAAAAGAAACGAAGGCTGTTATACTTGCGGTTCTCTCCATCATATTGC
TAAAGACTGTAGCAAAACTAGAAGAACTAGCAGCAATGGTAATAAAAATAGATGCTATAA
TTGTGGTTCAACTAGCCATAAGGTCAGAGACTGCCAGTAAGATTATTTAGTTAAAATAAT
TGAAAGTATAACGAATGTATTTAATAAAATAATAGTCAAAATAGAAGAAGCAGATCCAGA
GATAGAAGAAGAAGATCAAGATCTCGTTCTGACTCTAGAAGCAGTAAACCTTTTATTAAA
AATATATAAATCAACTCTGAAATTTGATCATCAAAACAAAATTTCAATAAGTGCAGTCGT
CTACAAAATCTTATTTAAATTAAAATGAAATAATGAAAAAATTAAACAAAAATTTTGCAA
AATAAAGAAAAAAGCTTGATTTTTGAAAAAAAGATTTTTGGTATATCAACAATTTCTTTA
TTTTAAGTAGGTGTCTCCCCACAATTTTATTTGCAAAGATAATTTAGATAATTAAGGATG
CAATTAATATAATTTCCTTCTATTTTATTAGATTTGTCTGTCTGTCTTAATTACATGATT
ATAACTTGACATTCAAAATTTTACTTCCTAAGTTTATTAATTATTTCAATAAAAAATATC
ATTTAAATTTAATATGAGATGGATTGATTTATTCTTGCTTTAACTTGATCAATTACAACC
AAAATTACAAAATTAAATTTTATAAAAAAATGAAAGAATTTCGATTTGAAATTTTTATAA
AATATTTTAAAATGAATTTCAGAAAAAACCACATTTTCAAATTGTAATTTATTTATTTAC
CTATTTACTTGTGAACTAACAGGAAGACAAAGAAGCAGATCTGACGACAGAAACAGAAGA
AGAAGAGACTCTCGCTCTGACTCTAGAAATAGAAGAAGAAGAAGAGATATGTCTAGATCT
AGATCCGCTGGTGACAGAAGAAAGAGAAGTAGTGATAGAGGTGATAGAAGAAGACCTAGT
CCTGATAATAGAAGAAGAAGATCAAGCTCAAGAGGTCAAAGAAGATCCGACAGCAGAAGC
TATAATAACAGAAATAATAACAGATCTAATTCAGCTGGTTCTCATAAAAATGATAGATCA
GGTAGCAATCTCAACAATGGAAACAATCAACCTGCTAACAACAATTCTTATAACAATGGT
AATAACAACAATTCTCGTTCTCCCTCCAGACAATCTAACTCAAATTGA