Identifiers and Description

Gene Model Identifier

TTHERM_00444830

Standard Name

RRM24 (RNA recognition motif-containing protein 24)

Aliases

PreTt03851 | 51.m00217 | 3704.m00073

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF07649 ) C1-like domain
  • ( PF08049 ) IlvB leader peptide
  • ( PF05172 ) MPPN (rrm-like) domain
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF06906 ) Protein of unknown function (DUF1272)
  • ( PF00642 ) Zinc finger C-x8-C-x5-C-x3-H type (and
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00444830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10872.19.997093137033517e-262hypothetical protein (857 aa)
OxytrichaContig22254.0.g556.000354955737408e-39RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02750051.9998323414791308e-36DDB_G0275005 on chromosome: 2
position 4898014 to 4903137
WormBaseWBGene000038274.000352986427571e-28locus:ntl-4 status:Partially
_confirmed protein_id:CDM634
96.1
SGDYER068W4.999723464643358e-28MOT2 Subunit of the CCR4-NOT c
omplex, which has roles in tra
nscription regulation, mRNA de
gradation, and post-transcript
ional modifications; with Ubc4
p, ubiquitinates nascent polyp
eptide-associated complex subu
nits and histone demethyase Jh
d2p
Stentor CoeruleusSteCoe_325140.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444830(coding)
ATGTCAGCAAAGATAAAACCAAAATAACCTCAGAAGAGATTGTAGTGTTAATATTGCAAG
GAAAAGATAGAAAATGACAATTACTATTTATGCGATTGTGGATATTAATATTTTAATCAA
TCACTTTAGACATAGGAGTGTTTTACCAAATTACTTTAGATTATCCAAATCCTTTTAGTC
ACTAAAATAAATATCAATAAGTTTTTTTCATATGGAATTCGAATAAAAAGAGAGTATTTT
CAATTTGAAGTATGTCTGATTGAAATGTGTTGGGATTGTTATGACGATTTTTAAGACAAT
TAAGAACCATTTTGCCCTAAATGTGATGCAGAATTAATATCTGACTCAGAAGACGAATAA
ATTACAAAACCTAAAAATGAGCCTCCACTTTCTAAATCTACTTCTCTATAAAATCAAGGG
GCTAATAGCCAACTGAAATCTTCACCATCAGCAGTAAATAAATCAAGTAGTAGCACTGTA
GGAGCAGCAAGTTCTGCAAATACAACTACTACCACATCATCAATAAATACTAGCGGTTTC
AACTATAATGATCTAGCAAAAGTAAGAGTTATCAAGAAAAATTTAGTATATGTGATTGGT
TTAGCTCCAGAGATAGCCAACGAAGAGACCTTGTTAAAGAAGGAATACTTTAGTTAGTAT
GGAAAAATAACAAAAATAGTTGTTAATACAAATAATGCATACAATCCAAAGGGACCAAAT
GGGCCTTCTTATTCAGCATATATAACATATTCTTCTGAAAGAGAAGCTTCTATGGCTATA
TTAGGAACAGAAGAGTATTAAATAAATGATAGAATAATTAGAGCTTCATATGGTACAACT
AAATATTGCTCTTACTTTTTAAAGTAGTAAGACTGTCCTAATTTACCTGAGTGTTTATAT
CTTCATTCATTTGGAAAAGATAAAGAATTTTTCTAAAAAGACGAAGCAACATCAAATAAA
AATATATTTATTGACCAATAAAAGATGGCTATAAAAAATATACAAAAATATATACCTGAT
CTAGTTAAAATAAAAAATACACCAGTGACATATAATTCTGTACTACCCACTCCATAAAGT
GTAATTGAAAAGTTAATTGAATAAGATGTCTTAGATATAAAACAAAAACCAGCAGAATCA
AATTCAAACGATTAAAAAGGTGATAAAAAGAAAAAAGAAGACAACACTCCTTTGATTGAT
TAGTGGAGTATCGATTTTTCTATTCCTCAAACAGCTCCTAAAAAAGATAAAGAGGATTCA
AAGAAATAGGAATCTTCTTCTCCACAATAAACAGTTAGAAAATAATCTAAATCAATATCT
GAAAAAGATCTCAATACAAATAATACATAACCAACTTCCAAGTCTCCTTAGTAGAATTAG
TAAAGCAGTACACCACCAGAAACATCTTCAAATAAATAACAAGAAGGTGAAAAATCTAAT
AAGATATAATAATCTGCTAATGGTTAGTAATAAAGTGAAGAAAAAGCTTTTTCAAAAGAG
GAGTTCTTAATGAAAGCTATGAATGGAGTTTTATAAAGTCCATCTCGCAGTCACTCTTCT
TCTCTTTCATTACAAAACAACACAAACACAAACTAAACATAGAATTAAAATATTATACAA
AACTCTAACTAAGGGAAACCTTAGTCATAAACTATATAAAATAATAGTTAAACAAACATT
ACAATAAATAATAGCAATTCGAATTCTAATCTATAAAAAGCTGCTAGCTAAGTTGTAGCT
GAGTAAACCAAAAAAGTAGAAAAATCTCCTATAAAAGAATAAATCTAGAAATAAGATGAA
TAAAAAAAAGACGAATAAATAGAAAGTAGAAAGACAGGAAACGCCTCTGCTGGAAGTAGC
AACTAATCTAGTAATGTAGCAAGTACAAATCACTCAAGGACTTCTTCTACTAATTAAAAA
GCATCTGGTTCAAATAGCTATCCTCAAAACTAAGCTTCTAATACAAATGGAATAAATAAT
AAATAAAACTCTGTCACTCAAAATGGAAATCATGCTGAAAAAAAAGAAACAAGCAGAAAA
GAGCAATCAGAAAATAAATATTAAAAACACTAATACATACCTGTAAATCAATAAACCAAG
CAGTCATCGCAATCAGTTGAACCTTAGAAGGAAACTAACTTATAAACTCAAAATGTTACA
TAGCAGCAACAACAATAGAATTAGTAATAGTCCCCTGCACCTCTTGAAAGTTAACCAAAA
TAAAAGGAAGACAACAAATAGGTAAAATCTTCAACTGCTTCTTAGCAAAAGCCTTAAAAC
GGTAGCCAAAATAGCTAATAAACTTAAACATAATAATAAAATCATTAAAACGAACAAGTT
AATATCCTGGCTTAATCTAAGTAGCAAAATACATAAAATGGCTTACAACAATAGGTTTAA
AATAGCTAAAATCATAATATATAAACTTCTCAGCACTAATAGAGCCCTAGTACTTCTACT
AGTAGTAGCAATGTTACTCCTCATAACTCCTCCATACATCCTCATCATTAGCATACAGTT
TCAGAACCTATTGCACCTAAATATATCCTATAAAAAGTAGAAAAAAGAGAAAAAACTTTA
AGCTCTGACAATTAAATTATGAAAAGACTGATTACAAGAACAACACATCAAAAAAGTGCT
TCTTCTCGCTTTGATTTTGCTAAAAACTCTGAAAATAGTGACTAACCTGTTGAAGATGTA
GATGTAATAAATCATATCTTTAATGGACAATATATAATCTTAACAAAGTCATATAATTAG
AGTTCGAATAATTTTGATAAAAATGAGTATTGA


>TTHERM_00444830(protein)
MSAKIKPKQPQKRLQCQYCKEKIENDNYYLCDCGYQYFNQSLQTQECFTKLLQIIQILLV
TKININKFFSYGIRIKREYFQFEVCLIEMCWDCYDDFQDNQEPFCPKCDAELISDSEDEQ
ITKPKNEPPLSKSTSLQNQGANSQLKSSPSAVNKSSSSTVGAASSANTTTTTSSINTSGF
NYNDLAKVRVIKKNLVYVIGLAPEIANEETLLKKEYFSQYGKITKIVVNTNNAYNPKGPN
GPSYSAYITYSSEREASMAILGTEEYQINDRIIRASYGTTKYCSYFLKQQDCPNLPECLY
LHSFGKDKEFFQKDEATSNKNIFIDQQKMAIKNIQKYIPDLVKIKNTPVTYNSVLPTPQS
VIEKLIEQDVLDIKQKPAESNSNDQKGDKKKKEDNTPLIDQWSIDFSIPQTAPKKDKEDS
KKQESSSPQQTVRKQSKSISEKDLNTNNTQPTSKSPQQNQQSSTPPETSSNKQQEGEKSN
KIQQSANGQQQSEEKAFSKEEFLMKAMNGVLQSPSRSHSSSLSLQNNTNTNQTQNQNIIQ
NSNQGKPQSQTIQNNSQTNITINNSNSNSNLQKAASQVVAEQTKKVEKSPIKEQIQKQDE
QKKDEQIESRKTGNASAGSSNQSSNVASTNHSRTSSTNQKASGSNSYPQNQASNTNGINN
KQNSVTQNGNHAEKKETSRKEQSENKYQKHQYIPVNQQTKQSSQSVEPQKETNLQTQNVT
QQQQQQNQQQSPAPLESQPKQKEDNKQVKSSTASQQKPQNGSQNSQQTQTQQQNHQNEQV
NILAQSKQQNTQNGLQQQVQNSQNHNIQTSQHQQSPSTSTSSSNVTPHNSSIHPHHQHTV
SEPIAPKYILQKVEKREKTLSSDNQIMKRLITRTTHQKSASSRFDFAKNSENSDQPVEDV
DVINHIFNGQYIILTKSYNQSSNNFDKNEY


>TTHERM_00444830(gene)
ATGTCAGCAAAGATAAAACCAAAATAACCTCAGAAGAGTACATTTTTTATCAATTTGAGA
TTAATATTATAAAAAAAAGGGCAGCACTGTTAATTTTTAAATGAGCTTCTAAAATGAATT
TATATTTTATTTTCAAAAAGGACGAAAATAGTTAAATTTATTCTAAATTTTTCCCTAAAG
TGAATTAGCAGTCACATTAAATTACATTATCTATAATACATTTTATCCTTTAAGCTTATA
AAATTATTGAAGAAGCATTTTAGTTTGCTTTTAGCTTAATAGACTGACTGACTGCTCTTC
TTTTTTTAAGTTTGCTTTAAAAATATTTTGTTTTTAAATAATTAGGATTGTAGTGTTAAT
ATTGCAAGGAAAAGATAGAAAATGACAATTACTATTTATGCGATTGTGGATATTAAGTAT
TTAAATTGTCTTTAATTTTATTCTTCATCTTTTTCAACAGATTAAACTATTTTAAATGTG
AAATTTTCTGAAAAGCAGTATTTTAATCAATCACTTTAGACATAGGAGTGTTTTACCAAA
TTACTTTAGATTATCCAAATCCTTTTAGTCACTAAAATAAATATCAATAAGTTTTTTTCA
TATGGAATTCGAATAAAAAGAGAGTATTTTCAATTTGAAGTATGTCTGATTGAAGTACAT
ATTTACTCTCTCTCGCGCTAATTCAAATATTAAAAGAAATTCATATTCGAATACTTTTTT
TTTTCATAATTAATTAGATGTGTTGGGATTGTTATGACGATTTTTAAGACAATTAAGAAC
CATTTTGCCCTAAATGTGATGCAGAATTAATATCTGACTCAGAAGACGAGTAAATAAAAT
ATATTAAATTAAATATTAAACTTTATTTGTGATTTTAAATTTAACAGATAGCACAGTAAT
TTTGGATTTACAAATAATTAAATTTATTATTTTTTTACTTATTAGATAAATTACAAAACC
TAAAAATGAGCCTCCACTTTCTAAATCTACTTCTCTATAAAATCAAGGGGCTAATAGCCA
ACTGAAATCTTCACCATCAGCAGTAAATAAATCAAGTAGTAGCACTGTAGGAGCAGCAAG
TTCTGCAAATACAACTACTACCACATCATCAATAAATACTAGCGGTTTCAACTATAATGA
TCTAGCAAAAGTAAGAGTTATCAAGAAAAATTTAGTATATGTGATTGGTTTAGCTCCAGA
GATAGCCAACGAAGAGGTATTTTGCATAAAGAAAATTTTGTATTTTAAAGTTATTAATCT
ATTAAAAATTATATAAATTAGACCTTGTTAAAGAAGGAATACTTTAGTTAGTATGGAAAA
ATAACAAAAATAGTTGTTAATACAAATAATGCATACAATCCAAAGGGACCAAATGGGCCT
TCTTATTCAGCATATATAACATATTCTTCTGAAAGAGAAGCTTCTATGGCTATATTAGTA
TTCAAATTATTTAAAAACTGAGAGTAAAATATTAACATTAAATTGATTATTTTAGGGAAC
AGAAGAGTATTAAATAAATGATAGAATAATTAGAGCTTCATATGGTACAACTAAATATTG
CTCTTACTTTTTAAAGTAGTAAGACTGTCCTAATTTACCTGAGTGTTTATATCTTCATTC
ATTTGGAAAAGATAAAGAATTTTTCTAAAAAGACGAAGCAACATCAAATAAAAATATATT
TATTGACCAATAAAAGATGGCTATAAAAAATATACAAAAATATATACCTGATCTAGTTAA
AATAAAAAATACACCAGTGACATATAATTCTGTACTACCCACTCCATAAAGTGTAATTGA
AAAGTTAATTGAATAAGATGTCTTAGATATAAAACAAAAACCAGCAGAATCAAATTCAAG
TAAAATTTTTAAAATTTAACAAGCAATTACAATTTAATATTTTTTAGACGATTAAAAAGG
TGATAAAAAGAAAAAAGAAGACAACACTCCTTTGATTGATTAGTGGAGTATCGATTTTTC
TATTCCTCAAACAGCTCCTAAAAAAGATAAAGAGGATTCAAAGAAATAGGAATCTTCTTC
TCCACAATAAACAGTTAGAAAATAATCTAAATCAATATCTGAAAAAGATCTCAATACAAA
TAATACATAACCAACTTCCAAGTCTCCTTAGTAGAATTAGTAAAGCAGTACACCACCAGA
AACATCTTCAAGTAGAATTTTTAATTAACAAAAAATTATTTGTACTACTAATCAATAATT
TATTTATTTTATAAAAATAGATAAATAACAAGAAGGTGAAAAATCTAATAAGATATAATA
ATCTGCTAATGGTTAGTAATAAAGTGAAGAAAAAGCTTTTTCAAAAGAGGAGTTCTTAAT
GAAAGCTATGAATGGAGTTTTATAAAGTCCATCTCGCAGTCACTCTTCTTCTCTTTCATT
ACAAAACAACACAAACACAAACTAAACATAGAATTAAAATATTATACAAAACTCTAACTA
AGGGAAACCTTAGTCATAAACTATATAAAATAATAGTTAAACAAACATTACAATAAATAA
TAGCAATTCGAATTCTAATCTATAAAAAGCTGCTAGCTAAGTTGTAGCTGAGTAAACCAA
AAAAGTAGAAAAATCTCCTATAAAAGAATAAATCTAGAAATAAGATGAATAAAAAAAAGA
CGAATAAATAGAAAGTAGAAAGACAGGAAACGCCTCTGCTGGAAGTAGCAACTAATCTAG
TAATGTAGCAAGTACAAATCACTCAAGGACTTCTTCTACTAATTAAAAAGCATCTGGTTC
AAATAGCTATCCTCAAAACTAAGCTTCTAATACAAATGGAATAAATAATAAATAAAACTC
TGTCACTCAAAATGGAAATCATGCTGAAAAAAAAGAAACAAGCAGAAAAGAGCAATCAGA
AAATAAATATTAAAAACACTAATACATACCTGTAAATCAATAAACCAAGCAGTCATCGCA
ATCAGTTGAACCTTAGAAGGAAACTAACTTATAAACTCAAAATGTTACATAGCAGCAACA
ACAATAGAATTAGTAATAGTCCCCTGCACCTCTTGAAAGTTAACCAAAATAAAAGGAAGA
CAACAAATAGGTAAAATCTTCAACTGCTTCTTAGCAAAAGCCTTAAAACGGTAGCCAAAA
TAGCTAATAAACTTAAACATAATAATAAAATCATTAAAACGAACAAGTTAATATCCTGGC
TTAATCTAAGTAGCAAAATACATAAAATGGCTTACAACAATAGGTTTAAAATAGCTAAAA
TCATAATATATAAACTTCTCAGCACTAATAGAGCCCTAGTACTTCTACTAGTAGTAGCAA
TGTTACTCCTCATAACTCCTCCATACATCCTCATCATTAGCATACAGTTTCAGAACCTAT
TGCACCTAAATATATCCTATAAAAAGTAGAAAAAAGAGAAAAAACTTTAAGCTCTGACAA
TTAAATTATGAAAAGACTGATTACAAGAACAACACATCAAAAAAGTGCTTCTTCTCGCTT
TGATTTTGCTAAAAACTCTGAAAATAGTGACTAACCTGTTGAAGATGTAGATGTAATAAA
TCATATCTTTAATGGACAATATATAATCTTAACAAAGTCATATAATTAGAGTTCGAATAG
TAAATTTTATTTCACAAAAAAAAATTTATAATTTTAAAATATTTAAAAAAATAAAAAATA
GATTTTGATAAAAATGAGTATTGA