Identifiers and Description

Gene Model Identifier

TTHERM_00444130

Standard Name

RRM23 (RNA recognition motif-containing protein 23)

Aliases

PreTt03781 | 51.m00147 | 3704.m00002

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00444130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10949.19.996894623038854e-156hypothetical protein (538 aa)
OxytrichaContig16218.0.g1011.0002335610448659e-38RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
Stentor CoeruleusSteCoe_143356.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444130(coding)
ATGAATTTACCATCTCAAAGCATATTCGATCCTGATTAGTTTACTTAGCAACAAACTGAA
AACTTGATAAATGAAGATTATTAAGATGGCATTTCTGCTATTTTAAAGCAAGGGTTAGAT
AATTAGCAAGGTTTGCAATAGATTTTTTACCCTTCTAGACCTAATAATTCTCACTTCATT
AATTAAGGATAGATTTTTCAATCTACCTAGTAGCAATAATAGCAGAATTTAATTTAACCT
ATGCAAGTGTTAACTAATGGAGAATTTTTAAAATAGTAAATGGCAAATCCCCTGTTCATA
AAATCTATTAAAGATAAATATTCATCTTACAGCCCAACGCTTAGATTGACAATGACACCT
CTTGACTAAAATGAAATAGAGCTTGATGAAGAGGATCTTTTAGGAGTTTTTGAAAGATTT
GGCAATCTTGAAGTTAAACTGGAATAAGGTGGTAAGGCTCTACTTGAATTTAAAGATATA
TATGGCGCTTATTTTGCATGGAATTCTTTGAACGGAGTTGAAATACCAAGCCAAAAGATT
TCAATAGGCTTAGATTGGTTATATGAAAATTAAAAATAGCAACAAAATTTCCCTCTCAAT
ACTTTAACTAATGTTCCTCCTATATCTATTAATGTAGGAAATTACACGCCAAATAACAAT
TGCAACTATAGTAAAAATATACAAAATGAAAACATGCATACTTCTTAGAACCCAACATAA
TAGCCTAACTCAGTACTTAAGCAAGCTAATTCAAACTATATTAACACTCCAAATAGCTCA
TCTAGTATCCGTACAAACGATGCAAGATCAAACAATTAAAATTTGAATCCTGTGTCCAAA
GGATAAAATTAAACTATTTAATCTAACATAATTAAAAATTAATCTAACTAAATTCAATCT
CATGCTAACATTGTAGGAGGAACTTGCTAAAATAACAATTTAAACATCATTTCACATTAA
AATTAGTCAAGCAATAATAACTAAGCTAGAGACGGATAAAATAACAGTTAGTCTGTTTCA
ACCTCACTAAGTAATAATTATGGGGGAAATAGTGCAATGAATAACCAAAATGGCTCTTAA
AACTCAAACAATAATTAATGTAATGGGAATAACGCTAATAATATAAAGTATACTTGCAGA
TATGAAATCCAAATATCTAATGATAAAGATTTCTAAGTTGCTCGCAAAATAATTGGCTCG
AGAGGAGAAAATATGAAGGCAATCATTAAGAAATGTTTGGATCACAACAAAAAAAAAGGT
GGATACAATTTGTAGAATGATGAAGAGCATGGTGTTAAGCTACGTTTAAGAGGAAAAGGA
TCTGGATATAAAGAAGGACCTGAAAAGCAAGAATCTCAAGAAGCTCTGCATCTATGTGTT
AGCTCGATGTATTATAATATGTATAAGAGTGCCTGCTATTTTGTTGAAGAGTTGCTACAA
AATATCTATGATGAATATTATAAGATGTGCTAACAGAATAACTTAAAGAGAGAAAGAGTG
CATATCAAAAAATAAGAGAGTACAAATGGAAAAGGAGGTTAAACGATCTCAACAGTGCCT
TAATAATAGTAGTAATAACAGTAGCAGCCCCAATAATAATAATCATAGCCACTTAATTAG
ATTCCTGCTAATCCTATGTAATAGCAGCAGTCATCAACTTAAAATCTTTAATAAATTCAT
AGTAATAATTCTATAATGAGCGGATCGAATACTTAGAAATAAAATAATTTATAATAACAA
TAAGTTTAATATTTACCAATTAATAAATCTTAACAAAATAATTCAAACCAATTAAATACA
ACTACTCTAAAGGATGCTTAGAATACCATCAACACCACCACCACTATCGCTTGTACAAAT
AACAACAATATTAACAATAACTCAGATTTAAACAACCAAATTAAATATGAAAAAATCATT
CCATTTTAGACTGATAAAAATTTTGAACTATCAAGCAGCACTTAATAAAGTTAAGGAGAA
AATTAAGAGTTTTTTTCTTCAAATGAAGATCTTGAAAAAAATTCATATGAGAATTCTTTT
ATTTAAAACTCCAACGAAAATGATTCAGATTCTCCAAGCTCAGCAAGTTTAAACAACCGT
TATGAAGGTTATGGTTATATTCATCTGTAAAACCCAAGTAATAGCAAAATGAGTGAAAAA
TAAATAATCAGTCTAATAGAGTAAAGAAATAAAGCTAGAAAAGAATCTAACTTCCAAGAA
GCTGACAGAATTAGAAACTTTTTAAAAAACAATGGCATAGCTCTGATGGATGAAAAAGGA
GGTAGAGGAAAAGGCTAGGATGTGACTACTTGGAAGTATTCGAAGAATAGCAATCCTTAA
TAGTAGTAATAATTGTAAAATAGTCCCAATGCAGCAAAATCTAATAATAATAATAATAAA
TAAAACAATAATTAACAATAAGTGCATTTACAGTAACAAATTTAATCATAAAATAATACT
AATACTCATTCTATAGTAAACACTAATAATAATAATATTTGA


>TTHERM_00444130(protein)
MNLPSQSIFDPDQFTQQQTENLINEDYQDGISAILKQGLDNQQGLQQIFYPSRPNNSHFI
NQGQIFQSTQQQQQQNLIQPMQVLTNGEFLKQQMANPLFIKSIKDKYSSYSPTLRLTMTP
LDQNEIELDEEDLLGVFERFGNLEVKLEQGGKALLEFKDIYGAYFAWNSLNGVEIPSQKI
SIGLDWLYENQKQQQNFPLNTLTNVPPISINVGNYTPNNNCNYSKNIQNENMHTSQNPTQ
QPNSVLKQANSNYINTPNSSSSIRTNDARSNNQNLNPVSKGQNQTIQSNIIKNQSNQIQS
HANIVGGTCQNNNLNIISHQNQSSNNNQARDGQNNSQSVSTSLSNNYGGNSAMNNQNGSQ
NSNNNQCNGNNANNIKYTCRYEIQISNDKDFQVARKIIGSRGENMKAIIKKCLDHNKKKG
GYNLQNDEEHGVKLRLRGKGSGYKEGPEKQESQEALHLCVSSMYYNMYKSACYFVEELLQ
NIYDEYYKMCQQNNLKRERVHIKKQESTNGKGGQTISTVPQQQQQQQQQPQQQQSQPLNQ
IPANPMQQQQSSTQNLQQIHSNNSIMSGSNTQKQNNLQQQQVQYLPINKSQQNNSNQLNT
TTLKDAQNTINTTTTIACTNNNNINNNSDLNNQIKYEKIIPFQTDKNFELSSSTQQSQGE
NQEFFSSNEDLEKNSYENSFIQNSNENDSDSPSSASLNNRYEGYGYIHLQNPSNSKMSEK
QIISLIEQRNKARKESNFQEADRIRNFLKNNGIALMDEKGGRGKGQDVTTWKYSKNSNPQ
QQQQLQNSPNAAKSNNNNNKQNNNQQQVHLQQQIQSQNNTNTHSIVNTNNNNI


>TTHERM_00444130(gene)
ATGAATTTACCATCTCAAAGCATATTCGATCCTGATTAGTTTACTTAGCAACAAACTGAA
AACTTGGTAATTGCTTAATTTATCAAATTATAACTAATTATTTAAACAGGAAATAAGACT
GTAGTTAAATTAAACTTCAAGTGTAGAGTTTCATTAATTTAGGATTTATTATTTTAAAAA
ATCAGATAAATGAAGATTATTAAGATGGCATTTCTGCTATTTTAAAGCAAGGGTTAGATA
ATTAGCAAGGTTTGCAATAGATTTTTTACCCTTCTAGACCTAATAATTCTCACTTCATTA
ATTAAGGATAGATTTTTCAATCTACCTAGTAGCAATAATAGCAGAATTTAATTTAACCTA
TGCAAGTGTTAACTAATGGAGAATTTTTAAAATAGTAAATGGCAAATCCCCTGTTCATAA
AATCTATTAAAGATAAATATTCATCTTACAGCGTAATATTATTCTTCATTCATTCATTAA
TTATATTTTTATACTATACCACAAAATTTACAAATTCCTGATATCAACCAGCAACAAGCA
TATATCAATAATTTTTTTAACAAAATACTTAGCCAACGCTTAGATTGACAATGACACCTC
TTGACTAAAATGAAATAGAGCTTGATGAAGAGGATCTTTTAGGAGTAAATTTTTAAATTC
AAATAGAAAATGATTTAAAACAAACTTAACGATATTATTAAACTATTTTTGGTAGGTTTT
TGAAAGATTTGGCAATCTTGAAGTTAAACTGGAATAAGGTGGTAAGGCTCTACTTGAATT
TAAAGATATATATGGCGCTTATTTTGCATGGAATTCTTTGAACGGAGTTGAAATACCAAG
CCAAAAGATTTCAATAGGCTTAGATTGGTTATATGAAAATTAAAAATAGCAACAAAATTT
CCCTCTCAATACTTTAACTAATGTTCCTCCTATATCTATTAATGTAGGAAATTACACGCC
AAATAACAATTGCAACTATAGTAAAAATATACAAAATGAAAACATGCATACTTCTTAGAA
CCCAACATAATAGCCTAACTCAGTACTTAAGCAAGCTAATTCAAACTATATTAACACTCC
AAATAGCTCATCTAGTATCCGTACAAACGATGTAATTAAAATACATTTTATTATTTTACA
AGACCACACATTATATTTTAAATAGAGTCTGCTTTAATTTTTAAAAGCACTGATTGAATA
TTTAAGAAAAATCTTTCAAAAGAGAGAAAAAAGAAGATGATTAAGAAAATTAATTAAATA
ATTAATAAATCAATCAATCAATTAATAAAAAATTATCTAATTTTTAACTGTTATTTTGTT
GTGTAAAATTTAATTTATAATAATTAGGCAAGATCAAACAATTAAAATTTGAATCCTGTG
TCCAAAGGATAAAATTAAACTATTTAATCTAACATAATTAAAAATTAATCTAACTAAATT
CAATCTCATGCTAACATTGTAGGAGGAACTTGCTAAAATAACAATTTAAACATCATTTCA
CATTAAAATTAGTCAAGCAATAATAACTAAGCTAGAGACGGATAAAATAACAGTTAGTCT
GTTTCAACCTCACTAAGTAATAATTATGGGGGAAATAGTGCAATGAATAACCAAAATGGC
TCTTAAAACTCAAACAATAATTAATGTAATGGGAATAACGCTAATAATATAAAGTATACT
TGCAGATATGAAATCCAAATATCTAATGATAAAGATTTCTAAGTTGCTCGCAAAATAATT
GGCTCGAGAGTAAAAAAATTTTAAATTAACTTTTATCAAAAATTGTTTAAATTTTAAAAC
TAAATTTGGAACTTAATCAAAAATTTTTGATATTCAAAGGGAGAAAATATGAAGGCAATC
ATTAAGAAATGTTTGGATCACAACAAAAAAAAAGGTGGATACAATTTGTAGAATGATGAA
GAGCATGGTGTTAAGCTACGTTTAAGAGGAAAAGGATCTGGATATAAAGAAGGACCTGAA
AAGCAAGGTAATTAATACATTTTAAAACAAAATAAATTTCTGAAATCTTTCTTAATTTTA
TACTACAGAATCTCAAGAAGCTCTGCATCTATGTGTTAGCTCGATGTATTATAATATGTA
TAAGAGTGCCTGCTATTTTGTTGAAGAGTTGCTACAAAATATCTATGATGAATATTATAA
GATGTGCTAACAGAATAACTTAAAGAGAGAAAGAGTGCATATCAAAAAATAAGAGAGTAC
AAATGGAAAAGGAGGTTAAACGATCTCAACAGTGCCTTAATAATAGTAGTAATAACAGTA
GCAGCCCCAATAATAATAATCATAGCCACTTAATTAGATTCCTGCTAATCCTATGTAATA
GCAGCAGTCATCAACTTAAAATCTTTAATAGTAATTAAATTTAAAATTTTGATCAAGGTT
TTTTTAAATAAATTATTTTTAAGAATTCATAGTAATAATTCTATAATGAGCGGATCGAAT
ACTTAGAAATAAAATAATTTATAATAACAATAAGTTTAATATTTACCAATTAATAAATCT
TAACAAAATAATTCAAACCAATTAAATACAACTACTCTAAAGGATGCTTAGAATACCATC
AACACCACCACCACTATCGCTTGTACAAATAACAACAATATTAACAATAACTCAGATTTA
AACAACCAAATTAAATATGAAAAAATCATTCCATTTTAGACTGATAAAAATTTTGAACTA
TCAAGCAGCACTTAATAAAGTTAAGGAGAAAATTAAGAGTTTTTTTCTTCAAATGAAGAT
CTTGAAAAAAATTCATATGAGAATTCTTTTATTTAAAACTCCAACGAAAATGATTCAGGT
ATTTTTAGTTATAATTAATTTTATATTAACACTCAATTTTATTAATCAAAACAAATTTTA
TATAGATTCTCCAAGCTCAGCAAGTTTAAACAACCGTTATGAAGGTTATGGTTATATTCA
TCTGTAAAACCCAAGTAATAGCAAAATGAGTGAAAAATAAATAATCAGTCTAATAGAGTA
AAGAAATAAAGCTAGAAAAGAATCTAACTTCCAAGAAGCTGACAGAATTAGAAACTTTTT
AAAAAACAATGGCATAGCTCTGATGGATGAAAAAGGAGGTAGAGGAAAAGGCTAGGATGT
GACTACTTGGAAGTATTCGAAGAATAGCAATCCTTAATAGTAGTAATAATTGTAAAATAG
TCCCAATGCAGCAAAATCTAATAATAATAATAATAAATAAAACAATAATTAACAATAAGT
GCATTTACAGTAACAAATTTAATCATAAAATAATACTAATACTCATTCTATAGTAAACAC
TAATAATAATAATATTTGA