Identifiers and Description

Gene Model Identifier

TTHERM_00443100

Standard Name

RRM22 (RNA recognition motif-containing protein 22)

Aliases

PreTt05710 | 50.m00279 | 3681.m00138

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07676 ) WD40-like Beta Propeller Repeat
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00443100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12642.19.997093137033517e-262hypothetical protein (731 aa)
DictyBaseDDB_G02835979.9981864321491e-40eif3B on chromosome: 4 positio
n 847464 to 849687
OxytrichaContig19782.0.g585.001052752541194e-37Eukaryotic translation initiat
ion factor eIF2A
WormBaseWBGene000012253.0010664139725277e-29locus:eif-3.B Eukaryotic tra
nslation initiation factor 3 s
ubunit B status:Confirmed
UniProt:Q9XWI6 protein_id:CA
A21681.2
Stentor CoeruleusSteCoe_1607.781132241133797e-20
SGDYOR361C1.000116773704384e-19PRT1 eIF3b subunit of the core
complex of translation initia
tion factor 3 (eIF3), essentia
l for translation; part of a s
ubcomplex (Prt1p-Rpg1p-Nip1p)
that stimulates binding of mRN
A and tRNA(i)Met to ribosomes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00443100(coding)
ATGGTCGATTTATACAAAGAAATAGATTTTTCTTAAGAATTAAAGGATACCCCAGAATTA
GAACCTTTCTTAAAAGCAAAAGCAAAAGAAGAATAGGAAGAATTGAGCTCAGATTATATT
CAAAAGCCATTCTTAGATAGATCATATCATGAGTTTATTATTGTTACTGGTTTACCCAAT
ACTGAAGCAGCAAAAACTGAACAATTTAAAACTTTCTTCTAAAATAAAATTCTTTAACCA
ACTGCTCTTCTTGAAAAGATTAAAGTTATCGAATTCTAACTTGACAACGATGGAAACTTT
TAAGGTATCTGCATTCTCGCTTTCGATAACGCTACTAATGCTTAAGAAGGTTTAAATAAA
TTGAACGGTCTTAAATTCATGAAATATTAATTGAGCGCTTATTCTTTGTATAGTTTCTAA
CAAGCTCTTGACTGTCCTGATGAATTCACAGCTCCTGTTAATTTGACCAAAAGAGAACTT
TTAGAGTGGAACTTTGAAAACAGAAAAAGTTTAATGTCATTATAAATCGGTAACAAGGTC
TATAATTACTGGGTTTCCCATCTAGAAAACGAACTTTAAAACATTTTAATGAAGCCTGTT
GAAGAAGGTTAAGCTCCAGTCAATCCTGAAAATTTGTACACACCCCTTGAAAGCTCTACT
AATGAAATCGTTTGGAGCAAGAATGGTACTTACATGGTTGAAATTTTACCTACTGGTTTC
AGATTATATGGTGGAAAAGATTTGAAAAAGCTTTCTTTCTTCCCTCACCCTGAAGTTAAA
AATATCGAATTCTCTCCTTGCGAAAACTATATTCTTTCTTATAACGGAACTATTGTCGAT
GCTCCTAATGAAGATAATTTCATCGTATGGTAACTTAACGAAGTTAAGGTACTCAGAGTT
TTCAAAGCTAAACAACAAGATGTTTGGACTACTATGAAATGGAGTTACGATGGTAAATAT
ATTGGTAAAATCGATGATCACAAGGTCTCCGTTTACGAACTCCCTGAAATGAAAATGCTT
GAAGATAGTTCAAAAAATCCTACATCAATAAATATTAGAAATGTACAGAAATTTTTCTGG
TCTAGCAAGTAAAATATTCTTATTGGCTGTTCTTACTATGGTCCTCATCGTGAACACGAT
AAGCAAGTCTCAACTAGAATTTCAATGTTTGAAATTCCTAGTAGAAGAGAATTCAAGTGG
AGAACAATTAGCAACGAAAGTTCTGATATTGATATTTTCCCAAGTGTCAATGGTCAATAC
GTTATTGCCATCATTAAAAAGATTAAGAATAAAAAATCTAATTAATAGTCCTCTTCCCAT
ACTATATAAGTTGCCAATATTCGTAACAAAGGTTAAATGGATATCTGTGAACAAGAAATT
AATGAAAAGGTTCACACTTACTCTGTCGATCCTTACTAAGGTCGTATTGGTTTAATTTAC
AAGGCTGGCGAATTAAGAGGAGAATAAAAGTCTATGATTTATCACACTTAAATTTACCAT
ATTGAAGAAGAAAGCAAGAGTTATACCATTAAAGATGCTGGTAGATTTAGCAATAAAAAT
ACAAACGAAATCTAGTTCTCTAACAGCAGTGGATTCTTTGTTTTGATTAATAAGGATATT
AATTCTTCCTATTGTGGTTATATGGAAACTGGTTTCACTCGTAAGGATAAGGGCAAATTA
ATTAGTGAAATTACCAGATCTTACAATAACTTATCATATATTGATAGTGCTGCTTACGAT
CAATCAGGACGTTACATATTTACTAGCTCTCAAAAAACAAAATCATTCCAAATTTGGACT
GCTTTTGGTGATTAAATTTTCAAGGATACTATAACTGACCCTGCTGGTATTAAAAATATA
ATTTGGAGACCTAGACTTACTCATTTACTTGACGAAAAGTAGGAATCATTAATCCAAACC
ACTTACAAGGATTACAAAAAAACCTACGAAGAAGAAGACGATAAGATTATCAATAAGAAA
GAACATGAAAGAAGAGAAAAAAGAGACAAATTAAAATAAGAATTCTTAGAATATTTAAAT
GCCAAGAGAAAAGAATGGAAAGATACTAAACAAGAAAGAGTTGCTCTTTTAGGTTTTGAT
GAAGAAGATGAGACTGATATTGTTTATGATGAATTCATTGAAAACGAAAGAGTTGTACAA
ACTGAAATCATTGATGAAGAAGAAATCGAAGATCCTAACAACTGA


>TTHERM_00443100(protein)
MVDLYKEIDFSQELKDTPELEPFLKAKAKEEQEELSSDYIQKPFLDRSYHEFIIVTGLPN
TEAAKTEQFKTFFQNKILQPTALLEKIKVIEFQLDNDGNFQGICILAFDNATNAQEGLNK
LNGLKFMKYQLSAYSLYSFQQALDCPDEFTAPVNLTKRELLEWNFENRKSLMSLQIGNKV
YNYWVSHLENELQNILMKPVEEGQAPVNPENLYTPLESSTNEIVWSKNGTYMVEILPTGF
RLYGGKDLKKLSFFPHPEVKNIEFSPCENYILSYNGTIVDAPNEDNFIVWQLNEVKVLRV
FKAKQQDVWTTMKWSYDGKYIGKIDDHKVSVYELPEMKMLEDSSKNPTSINIRNVQKFFW
SSKQNILIGCSYYGPHREHDKQVSTRISMFEIPSRREFKWRTISNESSDIDIFPSVNGQY
VIAIIKKIKNKKSNQQSSSHTIQVANIRNKGQMDICEQEINEKVHTYSVDPYQGRIGLIY
KAGELRGEQKSMIYHTQIYHIEEESKSYTIKDAGRFSNKNTNEIQFSNSSGFFVLINKDI
NSSYCGYMETGFTRKDKGKLISEITRSYNNLSYIDSAAYDQSGRYIFTSSQKTKSFQIWT
AFGDQIFKDTITDPAGIKNIIWRPRLTHLLDEKQESLIQTTYKDYKKTYEEEDDKIINKK
EHERREKRDKLKQEFLEYLNAKRKEWKDTKQERVALLGFDEEDETDIVYDEFIENERVVQ
TEIIDEEEIEDPNN


>TTHERM_00443100(gene)
ATGGTCGATTTATACAAAGAAATAGATTTTTCTTAAGAATTAAAGGATACCCCAGAATTA
GAACCTTTCTTAAAAGCAAAAGCAAAAGAAGAATAGGAAGAATTGAGCTCAGATTATATT
CAAAAGCCATTCTTAGATAGATCATATCATGAGTTTATTATTGGTAATTTGCCTTTATAT
TTTGCATAATATCCAAATGTCTAGATTCATCACAATCATTCATTAATTTGTTTGTTTGCA
AGAAAATTTCATTGATTTCTTATCTATTAAGGCTTTTTTTTATAAAATATTTTTTAATTA
TTATAGTTACTGGTTTACCCAATACTGAAGCAGCAAAAACTGAACAATTTAAAACTTTCT
TCTAAAATAAAATTCTTTAACCAACTGCTCTTCTTGAAAAGATTAAAGTTATCGAATTCT
AACTTGACAACGATGGAAACTTTTAAGGGTAAATTATTTATTAAGTTAAAGTGTATTAGA
ATTAATGACTGAAAATTTAACTTTAGTTAGTTAAATAAGATTAAGATAAAGAAAAATAAT
ATATTAATATAATATAAATTTTCAATTTTAAATCAATCATTAAGTTGTTTAATGTTTAAT
AGAAAATTAGTAATGTAAAAATTAGATGATGTTTAAATTTATTTTTAAAATTAAATCAAA
CAGTATCTGCATTCTCGCTTTCGATAACGCTACTAATGCTTAAGAAGGTTTAAATAAATT
GAACGGTCTTAAATTCATGAAATATTAATTGAGCGCTTATTCTTTGTATAGTTTCTAACA
AGCTCTTGACTGTCCTGATGAATTCACAGCTCCTGTTAATTTGACCAAAAGAGAACTTTT
AGAGTGGAACTTTGAAAACAGAAAAAGTTTAATGTCATTATAAATCGGTAACAAGGTCTA
TAATTACTGGGTTTCCCATCTAGAAAACGAACTTTAAAACATTTTAATGAAGCCTGTTGA
AGAAGGTAATACTTTGTTTATTTCAATAAAAGATATTTTTATTTTCTTCTTTTTAAAAAA
ACAAAAAAAATTAATAAATCAAAAGTTTTTTTAATTTTAGCTTAGTTAGCAAAGTGCTAC
TTGATAATTATTTTAAAAATGGATAGAAAATCAATCGCAATCAATTAAAAAAAACAAATC
AACAATTAACAACCCTTTTAACAATATATTTTGATAGAAATAAAACCTAATTTAGCAATT
ATAATATTTTTTTACTCAATAAAAATTAATTATGCAAATCAGCCACATTAAATTGATAAT
CAGAAATAATCATCGAAATTAACATGCATTAATTTTTATAAAATACAAACGCTTTTTATA
TTGAGATTGTAATATTCTTTTTTATGCCAACAATTAGGTTAAGCTCCAGTCAATCCTGAA
AATTTGTACACACCCCTTGAAAGCTCTACTAATGAAATCGTTTGGAGCAAGAATGGTACT
TACATGGTTGAAATTTTACCTACTGGTTTCAGATTATATGGTGGAAAAGATTTGAAAAAG
CTTTCTTTCTTCCCTCACCCTGAAGTTAAAAATATCGAATTCTCTCCTTGCGAAAACTAT
ATTCTTTCTTATAACGGAACTATTGTCGATGCTCCTAATGAAGATAATTTCATCGTATGG
TAACTTAACGAAGTTAAGGTACTCAGAGTTTTCAAAGCTAAACAACAAGATGTTTGGACT
ACTATGAAATGGAGTTACGATGGTAAATATATTGGTAAAATCGATGATCACAAGGTCTCC
GTTTACGAACTCCCTGAAATGAAAATGCTTGAAGATAGTTCAAAAAATCCTACATCAATA
AATATTAGAAATGTACAGAAATTTTTCTGGTCTAGCAAGTAAAATATTCTTATTGGCTGT
TCTTACTATGGTCCTCATCGTGAACACGATAAGCAAGTCTCAACTAGAATTTCAATGTTT
GAAGTAAGCATTTAAATATTAAAATCAAATTGTTTTTATTTACATATACTGACATTAATT
TGTAATAAAAAGATTCCTAGTAGAAGAGAATTCAAGTGGAGAACAATTAGCAACGAAAGT
TCTGATATTGATATTTTCCCAAGTGTCAATGGTCAATACGTTATTGCCATCATTAAAAAG
ATTAAGAATAAAAAATCTAATTAATAGTCCTCTTCCCATACTATATAAGTTGCCAATATT
CGTAACAAAGGTTAAATGGATATCTGTGAACAAGAAATTAATGAAAAGGTTCACACTTAC
TCTGTCGATCCTTACTAAGGTCGTATTGGTTTAATTTACAAGGCTGGCGAATTAAGTAAG
ATCAATAATTTATTTTGGATAGCTTATAAATTTTAAATTAAATTTGCAAATTATTAGGAG
GAGAATAAAAGTCTATGATTTATCACACTTAAATTTACCATATTGAAGAAGAAAGCAAGA
GTTATACCATTAAAGATGCTGGTAGATTTAGCAATAAAAATACAAACGAAATCTAGTTCT
CTAACAGCAGTGGATTCTTTGTTTTGATTAATAAGGATATTAATTCTTCCTATTGTGGTT
ATATGGAAACTGGTTTCACTCGTAAGGATAAGGGCAAATTAATTAGTGAAATTACCAGAT
CTTACAATAACTTATCATATATTGATAGTGCTGCTTACGATCAATCAGGACGTTACATAT
TTACTAGCTCTCAAAAAACAAAATCATTCCAAATTTGGACTGCTTTTGGTGATTAAATTT
TCAAGGATACTATAACTGACCCTGCTGGTATTAAAAATATAATTTGGAGACCTAGACTTA
CTCATTTACTTGACGAAAAGTAGGAATCATTAATCCAAACCACTTACAAGGATTACAAAA
AAACGTAAATTTTAAATTATTAATGAAACACCATAATAGTAAAATGTTAAAAAAATAGCT
ACGAAGAAGAAGACGATAAGATTATCAATAAGAAAGAACATGAAAGAAGAGAAAAAAGAG
ACAAATTAAAATAAGAAGTAATAATATTAATTGATATGTTATAATTAATAATAATAATAA
TTTATTATAAAATATAAGTTCTTAGAATATTTAAATGCCAAGAGAAAAGAATGGAAAGAT
ACTAAACAAGAAAGAGTTGCTCTTTTAGGTAATTAATTAATTAATTAATTTTATTAAGTA
TATTAATAATTTTATTCACTTATTTATATAGGTTTTGATGAAGAAGATGAGACTGATATT
GTTTATGATGAATTCATTGAAAACGAAAGAGTTGTACAAACTGAAATCATTGATGAAGAA
GAAATCGAAGATCCTAACAACTGA