Identifiers and Description

Gene Model Identifier

TTHERM_00427410

Standard Name

RRM21 (RNA recognition motif-containing protein 21)

Aliases

PreTt14077 | 47.m00272

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00404 ) Dockerin type I repeat
  • ( TIGR01649 ) hnRNP-L/PTB/hephaestus splicing factor family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12%

TetraMine Data

TTHERM_00427410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00155.19.997093137033517e-262hypothetical protein (571 aa)
WormBaseWBGene000042070.0000000010002658722841845locus:ptb-1 status:Confirmed
UniProt:Q8T3E6 protein_id
:CAD30435.1
DictyBaseDDB_G02843210.000000007002490258088747DDB_G0284321 on chromosome: 4
position 1760065 to 1764027
SGDYER165W0.000019995566179747357PAB1 Poly(A) binding protein,
part of the 3-end RNA-processi
ng complex, mediates interacti
ons between the 5 cap structur
e and the 3 mRNA poly(A) tail,
involved in control of poly(A
) tail length, interacts with
translation factor eIF-4G

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00427410(coding)
ATGGAAAATAGCAATGAAAAATCATTATAATTAATTAATTGCTGCAAAAAACAAAGACTA
ATTAAATTGATAATAATCATTTAAGAAACAATAAGCATAGAAATTTATCTTCAATTTAAT
ATGAATATCAACTAATCTACAAAAGATGAAATGACTGAGCAGAAGGTTTCTCTTAGCTCC
AGGATATCAGTTTCAGATTAAATCAATGAATTAAAATAATCAAAACCAAAGGAGACCCGA
GTGCTCCTTGTAACTCTTGTTAATAACGTTAATAACACTGTTTTGTAACATAATGTTTAC
TACCAAGCCTTTTCTAATTATGGAGAAGTCCAAAGAATCTTGATTTTCCAAAAAATATCA
CCATGGGCTACTTTTATAGAAATGGATACTGTTGAAAATGCGCGTAATGCAAGATAAAAA
TTAAATAACTTTTAGATATTACCCGATGGAACTAAATTCGTAATTTTGCCTTCAACAAAA
GAAAGAATTGAATTTTAAGAAAAAAATGTTTCTGGCATAGATTATACAATTCTCAAGTAA
AAGATCTTGGAAAGACAAATCAACAATGAAGCAGAAGCCTTGTTTGAATAGCTTCTCAAA
GTAGATGATATTATTGAAGATGGCAATTCACCTTAAAAATAGCTGATTTCAAGTGATAAT
TAAGAAGTTACTATTTCATACCATTCTAGCTAATCTTCAAACGCAACATTTAATTCAGGA
AATAATTCTAAAGTAAAGGGAATTAAGAATTTTAATAATAACAACGCTAATAGCAATAAT
TATAATTTTAAACCTACAAACTATAACAGCTAAAAAAATTCACTTCATAATTCTTTTTCA
TAAGAAGAGGTGAATGATTAAAGCAACTACTCTCATATGGCTAATGAATCATCTGTGCAC
ACAGAATTAGATGATTTAAATCTAGCTCAATCTGTTTATTCAAATGTGAGTGAGGAGTAA
AATGGCAAATATCACACATCAATTAGTAATAGCAACATAAAAAATAACTCCATTCATTCT
GATAACTCATTAAATTTCGGTAAAAAGGCTGTTTGTAGCACTACTAGCCGTAATTAAGGC
TAAAGCTTCTAAAAGCAAGGACATAACTTAACCAATTCTGCTCCAAACGACCTTTGCTTT
TAAAAATCCTCAAATAGTTTACAAAGTGATATATATGAAAATGTTGATGAAAAAACAGAT
ATATCTCAATATGTTCATCCACAGTTCTCTTAAATGATAAAGAAGTCAAAAGTAATCTAT
GTTAATAGATTTGACTCTTCTAAAACTACAATGTAGTAAATTTTTAACTTGTTCAGCGCA
TTTGGCAATATTGTTAAGATGATTTTCATGAAATCAAAATCAGCTGTTTTGATCGAATAC
TCTACTGTTGACTTTGCTTGTTAAGCTAAAGATTTGTTGAGCGATACAACTTTTAATGGC
AACATTATAAAAATATTTTATTCAAGATATGAAAATATTTTCTTCAAAGAAGCAGAAGAA
AAGCCAGAAGACGAAGAATACTTTGAACCTAATGAGAAATTAAATAGATTTAAAAGTGAC
GCTCAGGCCATTATAAATACTCCTATTGATACTTTACACATATCTAATATTAGAATTAAC
GATTGCAACTTCGAAACAATAAAAAAAATTACAGAGCCTTATGGTCAAATTAAAAAAATA
AAATTCATGCTTGAAAAAAATAACAAAAATATGTGTTTAGTCAAATTTGAAACAGTATCA
ATAGCTATGTGGGTTTTAGCTAATGTTCACAATAAAATGATTTCTGATAGACCAATCAAA
ATTTCTTTTTCGAAAAGAACTTTGGAATGA


>TTHERM_00427410(protein)
MENSNEKSLQLINCCKKQRLIKLIIIIQETISIEIYLQFNMNINQSTKDEMTEQKVSLSS
RISVSDQINELKQSKPKETRVLLVTLVNNVNNTVLQHNVYYQAFSNYGEVQRILIFQKIS
PWATFIEMDTVENARNARQKLNNFQILPDGTKFVILPSTKERIEFQEKNVSGIDYTILKQ
KILERQINNEAEALFEQLLKVDDIIEDGNSPQKQLISSDNQEVTISYHSSQSSNATFNSG
NNSKVKGIKNFNNNNANSNNYNFKPTNYNSQKNSLHNSFSQEEVNDQSNYSHMANESSVH
TELDDLNLAQSVYSNVSEEQNGKYHTSISNSNIKNNSIHSDNSLNFGKKAVCSTTSRNQG
QSFQKQGHNLTNSAPNDLCFQKSSNSLQSDIYENVDEKTDISQYVHPQFSQMIKKSKVIY
VNRFDSSKTTMQQIFNLFSAFGNIVKMIFMKSKSAVLIEYSTVDFACQAKDLLSDTTFNG
NIIKIFYSRYENIFFKEAEEKPEDEEYFEPNEKLNRFKSDAQAIINTPIDTLHISNIRIN
DCNFETIKKITEPYGQIKKIKFMLEKNNKNMCLVKFETVSIAMWVLANVHNKMISDRPIK
ISFSKRTLE


>TTHERM_00427410(gene)
ATGGAAAATAGCAATGAAAAATCATTATAATTAATTAATTGCTGCAAAAAACAAAGACTA
ATTAAATTGATAATAATCATTTAAGAAACAATAAGCATAGAAATTTATCTTCAATTTAAT
ATGAATATCAACTAATCTACAAAAGATGAAATGACTGAGCAGAAGGTTTCTCTTAGCTCC
AGGATATCAGTTTCAGATTAAATCAATGAATTAAAATAATCAAAACCAAAGGAGACCCGA
GTGCTCCTTGTAACTCTTGTTAATAACGTTAATAACACTGTTTTGTAACATAATGTTTAC
TACCAAGCCTTTTCTAATTATGGAGAAGTCCAAAGAGTAATTCAGTTTATAAAATATATA
ATCTCCTTTGAATTTCAAAGAATTTAGTTTTATTTCTGCTTAACCGCAAGCAGTAAAAAT
AAAATATTTTTTCTTTAAAAAATATATCCTCAGTTTTTAATATAAATTCTAAATTTAGAT
CTTGATTTTCCAAAAAATATCACCATGGGCTACTTTTATAGAAATGGATACTGTTGAAAA
TGCGCGTAATGCAAGATAAAAATTAAATAACTTTTAGATATTACCCGATGGAACTAAATT
CGTAATTTTGCCTTCAACAAAAGAAAGAATTGAATTTTAAGAAAAAAATGTTTCTGGCAT
AGGTAAAAATATTAATTTAATTCTATTTATATTATAAACTCATCATGAATGAATGAATGA
AATGATTATATATTGATCAATTCATAACCAGCAGCACTCAGCTTAATAAATAATATCTTC
TTAAAATTGATGATTGCTAGCCAGCTAATTCAATAAATTAATTTAAAGCCAATTTTTAAT
AATTTGATTAATTTTTTTTCATTTAATTGGTTTTTGATTATTAAGAGAACGAACACAATT
AACAAATTCAAAACAACCTATTACACATTTTTTTTTTTCGAGAGAGTAAAAATCGTTTCA
GTGAATTGCTTCGACATATTCCACAACCAAAATATTTGAGAAATACTTCAGATTTTTAGT
TATTTAGAATCTCAATTTATGATTGAAGAAAGCCATAAGGCTATTTTTTAGAAAAGTATT
CGTTGATTGCAAAATTATTTGAAAAAATGTTTTAATGTCATTAAAATTTACCAATAACCA
TAAAATTACTAGTTTTTTGAAGGAAAATTTTACCATGAGTAAATAAAATTACAAAATTCT
TTCAATATTTTTACAATTAACAAGGACTTTATAGAAAAATAAATAAATAATTTTTAAGTT
CTAAGTAAAATTAAAAAGCTGTTTGTTTCCATCAATCAAATTTATTTAACAAATCAATAA
AAGGCTATTCTTATAATAAGAAAATTTTCTGGTTAAAGCAATTTATTTTTTATTCATAAA
AGATATTTTACAGTTATGCAAATATATTTTTTGGCAAAACAAACATTTTGTAATGAGTTA
GCTAGCTCCTAAATTAATTGTCTTTATTTAGCTTTCTTAACGAATTCAAATTATTTAAAA
AGATTATACAATTCTCAAGTAAAAGATCTTGGAAAGACAAATCAACAATGAAGCAGAAGC
CTTGTTTGAATAGCTTCTCAAAGTAGATGATATTATTGAAGATGGCAATTCACCTTAAAA
ATAGCTGATTTCAAGTGATAATTAAGAAGTTACTATTTCATACCATTCTAGCTAATCTTC
AAACGCAACATTTAATTCAGGAAATAATTCTAAAGTAAAGGGAATTAAGAATTTTAATAA
TAACAACGCTAATAGCAATAATTATAATTTTAAACCTACAAACTATAACAGCTAAAAAAA
TTCACTTCATAATTCTTTTTCATAAGAAGAGGTGAATGATTAAAGCAACTACTCTCATAT
GGCTAATGAATCATCTGTGCACACAGAATTAGATGATTTAAATCTAGCTCAATCTGTTTA
TTCAAATGTGAGTGAGGAGTAAAATGGCAAATATCACACATCAATTAGTAATAGCAACAT
AAAAAATAACTCCATTCATTCTGATAACTCATTAAATTTCGGTAAAAAGGCTGTTTGTAG
CACTACTAGCCGTAATTAAGGCTAAAGCTTCTAAAAGCAAGGACATAACTTAACCAATTC
TGCTCCAAACGACCTTTGCTTTTAAAAATCCTCAAATAGTTTACAAAGTGATATATATGA
AAATGTTGATGAAAAAACAGATATATCTCAATATGTTCATCCACAGTTCTCTTAAAGTAA
AATTTACATTAAAAATATTCTTTTTTTAAAATAAAATTGTTGTTATTACTGAATTAAGAA
AATATTTTTCAAAAAATACAAACTTTTATCAAAAAAGTTTATTGTAAGTAATTATTGTTA
CTTGTAATTCACTTACCAAAAATTATTAAAGAATTTTAAGGTAAGTAAAATCTAATTTGT
TGCGAATTAAAAAAAAACCATTAAAATTTAAAAATCGCATAATACAAAAGTTTAAAAAGC
CTCTCTCAAATTAGTTATCTAAAATTTAGAACCTTCGACTATAAAAATACTATTTAAAAT
ATATTTCAAAGAGCTTAATCCAATTTATAAAAATATTAGCTTCATTTTCTCATATTAATT
AATTTTTATTTTATGAATATAGTGATAAAGAAGTCAAAAGTAATCTATGTTAATAGATTT
GACTCTTCTAAAACTACAATGTAGTAAATTTTTAACTTGTTCAGCGCATTTGGCAATATT
GTTAAGATGATTTTCATGAAATCAAAATCAGCTGTTTTGATCGAATACTCTACTGTTGAC
TTTGCTTGTTAAGCTAAAGATTTGTTGAGCGATACAACTTTTAATGGCAACATTATAAAA
ATATTTTATTCAAGATATGAAAATATTTTCTTCAAAGAAGCAGAAGAAAAGCCAGAAGAC
GAAGAATACTTTGAACCTAATGAGAAATTAAATAGATTTAAAAGTGACGCTCAGGCCATT
ATAAATACTCCTATTGATACTTTACACATATCTAATATTAGAATTAACGATTGCAACTTC
GAAACAATAAAAAAAATTACAGAGCCTTATGGTCAAATTAAAAAAATAAAGTAAAAATTC
TTTTTTAATTTATTCCAAATTGAATTTCATAAAAAATATTTAAATAAAATAAATTTAATT
TTAATTCTTCAAATAAAAAACTTTATTAAATAAAATAAATAGATTCATGCTTGAAAAAAA
TAACAAAAATATGTGTTTAGTCAAATTTGAAACAGTATCAATAGCTATGTGGGTTTTAGC
TAATGTTCACAATAAAATGATTTCTGATAGGTAAAATAAAAATTCATTTTTAATAATATT
TGTTTTTTTAAAATTTATTTCTTTAATAAATTAACTAACTTAATTTTTTATAAATTAAAG
ACCAATCAAAATTTCTTTTTCGAAAAGAACTTTGGAATGA