Identifiers and Description

Gene Model Identifier

TTHERM_00421020

Standard Name

RRM20 (RNA Recognition Motif-containing protein 20)

Aliases

PreTt07227 | 46.m00282 | 3679.m00132

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00397 ) WW domain
  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( TIGR01648 ) hnRNP-R, Q splicing factor family
  • ( TIGR01659 ) sex-lethal family splicing factor
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00421020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10972.19.997093137033517e-262hypothetical protein (797 aa)
WormBaseWBGene000068079.99967697349061e-30locus:unc-75 status:Confirme
d UniProt:G5EE68 protein_i
d:CAB03896.4
DictyBaseDDB_G02914867.002116201343823e-26DDB_G0291486 on chromosome: 6
position 413873 to 415521
OxytrichaContig18677.0.g102.000769134519826e-18RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
SGDYGR250C0.000000000003998907168546896YGR250C Putative RNA binding p
rotein; localizes to stress gr
anules induced by glucose depr
ivation; interacts with Rbg1p
in a two-hybrid
Stentor CoeruleusSteCoe_102590.00000000003775134544279098

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00421020(coding)
ATGAATTCAAGTTCCAGTAGCAAATCAAATAAATTGGGAGGTCAGTAATACTATCATCAA
GAAAAGCATTATAAAAACGCTGAATAAGAAGATTCTAATTCCTCTCTTGAAAACAAATCA
AAAGGCGGCTAAAAATATAAAAGAAAATAAGTTGAAATAAAGCTATTTGTAGGCCAAATC
CCTAAAACATGGGAAGAGAATGATTTGAAAACATTTTTTGAGAAGTATGGTGAAATTGTG
AAAGTTTAAGTAATCAGAGACAAAAATAATTAGCACAAAGGGTGTGCTTTTGTTGTTTTT
GCCTCTATTTTATGCGCCAATATTGCAATTGAAGCTCTCAAAGCAACTAAATTGCCTGGA
ATGTAAAACAACATACAGGTTAAGTGGGCTGATAATGAGCCTGATAGGCTAGGAATCAGA
CAAGACCAAGACTATGTCTTATATGTAGCTCATATTCCTAAAAATGCATCAGAGCCTGAA
ATAAGAAATGTTTTTGAAAACTATGGAATTGTTAAAGAAGTTGATATCCCTAAAGATTAA
TCTGGAACAAGCAGAGGATTTGTTTTTGTGAAATTTGAAAATATTGAACAAGCTATTTTA
GCCAAATAGGCTCTCCATGAAAAATAAGTTTTAAATAATCAAACACAGTCCTTAGTGGTC
AAGTTTTATGATCCTAAAAAGAAATAAACTCAAGGAAATTAAGGACCATAGTAAGGTCAA
TCTGGCAATTCTTCAAACAATTACAACAACAATGGACAGGGATAGCCTCATCACTCAAAT
AGGGATAACTAAGGACAGTCTAATTATTATCCATCTTCTTCATAGCCTTAAATGTACTCA
TAAGGTTAATAGCCTAACCAAAGAAACTCTGACAATTATAATTACCAAAGAGAATAGCAC
TCTAATTATAACTAAGGAAGCTAGTCATAAGGATATAGAGGAGGATAAGGAAATTATCAC
GGGCATCATGAAAGCAAAGGGTCCTATAACTAAAATAATTAAAATTACCCAAGAGAAAGT
GCCAATTTAAACAACAGTGAACATTATGATTAGCCAAGCTAGTCGTTCGATAGCTTCTAA
AGTCACTCTTCTAATTTTAGAGAGTAATATGGCAATCAAAATCTCCAATAATCATAACAT
AATAACGGTTATCCTCACCATAATCGTAACAACAACAGCAACAACAATAACAGTAATAAT
AGCAGCAACAATAACTTTTAGTATAGCAGTAGCTACCCCTCTAATTAGCCTGCTGGAAAT
AATTTGAGCAATTAGCAATTTAATTAAACTTATAATAACAGCAACTAGAGTAATGACTAT
AACTACCAAAACCCTTAGTAAAACGACTATGTTCCTCCACCACAAGGACAAAATAACTTT
TAGTTTAATGATTATTAACAGCAGCATCACAGTAATAATAATGGACCTGTTCCAAATAGT
GCTAATAATAATTAAATTTAATAGTTTAATCCATACTATAATAACGAAAATTTTGATAAC
TATAACAATCCTTAGATTCACAACGAATAGCCCAGCTTTACTCCAAATTAACCTCCATAA
TAAATACCTTAACATGAAATAAATTAACCTCCATTATTCAATATGCCATAATAATAACAA
CAACCAATAAACCCATAGCCTTCATTAGACATTTCTTAGCCTAGTAGTGGTTACTAAGAG
CCAATCCCTGCTGTAGAACCTAATTAATAGCCAATTTAACAAAAAGCCTATATTAAGTAT
TACACTGATGACAAAGTCCCTTATTACTATGATACTCAAACTTAATCTACATCATATGAC
TAACCTCCTTTAGGATCGATAATATATAATCCAGATGGAACACAAGAACATGTATAACCA
GAAAGCATCGAACAACTGCAAAAATTTTAACAAGAAACAGGATTAGCAGAAAATAAAGAA
CTTGAAATTTTATCCTAAAAAACAACAGGACCTCCAGGAGCTAATTTATTCATTTTCCAT
CTTCCAAACGACTACCGTGATTCAGATCTTTTAAGACTCTTCAAAAAATTCGGTGATTTG
CTCTCCGCAAGAGTTATCACACGTCCTGATGGTTCTAGCAAAGGCTATGGTTTTGTAAGT
TATACAAGCCCAGATGGTGCTCAACAAGCTATACAGTAAATGAATGGCCTATAAGTTGGA
AGTAAATAAAAATTAAAGTATGAGTTTTAAATTAAATATAATTTACATTAAATAGAGAAA
AAGCTAAAAGTAGAAGTAAAAAAAGGTCAAGGTGATGGAGATTTACCACCTAGTCTTAGT
TAAAATGGATATTAACCCTTTTGA


>TTHERM_00421020(protein)
MNSSSSSKSNKLGGQQYYHQEKHYKNAEQEDSNSSLENKSKGGQKYKRKQVEIKLFVGQI
PKTWEENDLKTFFEKYGEIVKVQVIRDKNNQHKGCAFVVFASILCANIAIEALKATKLPG
MQNNIQVKWADNEPDRLGIRQDQDYVLYVAHIPKNASEPEIRNVFENYGIVKEVDIPKDQ
SGTSRGFVFVKFENIEQAILAKQALHEKQVLNNQTQSLVVKFYDPKKKQTQGNQGPQQGQ
SGNSSNNYNNNGQGQPHHSNRDNQGQSNYYPSSSQPQMYSQGQQPNQRNSDNYNYQREQH
SNYNQGSQSQGYRGGQGNYHGHHESKGSYNQNNQNYPRESANLNNSEHYDQPSQSFDSFQ
SHSSNFREQYGNQNLQQSQHNNGYPHHNRNNNSNNNNSNNSSNNNFQYSSSYPSNQPAGN
NLSNQQFNQTYNNSNQSNDYNYQNPQQNDYVPPPQGQNNFQFNDYQQQHHSNNNGPVPNS
ANNNQIQQFNPYYNNENFDNYNNPQIHNEQPSFTPNQPPQQIPQHEINQPPLFNMPQQQQ
QPINPQPSLDISQPSSGYQEPIPAVEPNQQPIQQKAYIKYYTDDKVPYYYDTQTQSTSYD
QPPLGSIIYNPDGTQEHVQPESIEQLQKFQQETGLAENKELEILSQKTTGPPGANLFIFH
LPNDYRDSDLLRLFKKFGDLLSARVITRPDGSSKGYGFVSYTSPDGAQQAIQQMNGLQVG
SKQKLKYEFQIKYNLHQIEKKLKVEVKKGQGDGDLPPSLSQNGYQPF


>TTHERM_00421020(gene)
ATGAGTAATTTTATGATTTATGAAATTTATGAACCTCTTTTAATATAGGAAGAAATTTTA
TATACAAAAAAAGAAGAATATTTGATTGATTGACTCAGTATTAATAATTGTTACATGCAT
GCTATTATTCTCTACATTACAGCAATCAAATTCATTTTATATTATATTTCAAATGCAATT
TTAACAATGTGAAATTTGATTTAATCTTCATTACAATAATGAGGATATTATTTTACATGC
AAACATTTTTTATGAACGATTTTAACTTATTATTCAACCTAACCTTCCTTTTCTATTATT
TGTACAATTCTTAGATTCAAGTTCCAGTAGCAAATCAAATAAATTGGGAGGTCAGTAATA
CTATCATCAAGAAAAGCATTATAAAAACGCTGAATAAGAAGATTCTAATTCCTCTCTTGA
AAACAAATCAAAAGGCGGCTAAAAATATGTGCGAAACAATCATATAATTTATTTATTTAT
TTGCATATTTTATGAAAGTATCTGCAAGAGATTGATAAACAATTTCAAAATTCTCAAAAA
AAAAAAAATAAACTCATTTGAGAAATTATTAAAACTTAGAAAGCAGATACCAAAAAAATT
TGATGCACAAGCTCATAGACTATAATAATATATTGATGTATTTTTCTTTTAAATATAGAA
AAGAAAATAAGTTGAAATAAAGCTATTTGTAGGCCAAATCCCTAAAACATGGTATCATTT
TCTTTTTGCATTTCTATTTTATATTTTTATGTAGGATGACACTACTAACTAACCTTGGGT
GATGCTGCAAAAAATTAAGATTAAGAAAGAATACATTTCATTTCATTACATGCATGAATC
AATCAATCAATAACTTATTTTTAATTATAATCAAAAATAAATAACACAAAATTTATTTCA
TTTGCTCTATTAATAAAATATGTATAAAATTTTATTAATAGACACATATAAACAATTAAT
ATTTAATCAAATTCTGTACTGCACCTTTTTTACAGTTTAATTAAATTTTGATTCTTTCTC
TTGTTTTTTTTGAAAGCTATCACCCTAGCAAATAAATTTTCATTTATAATTAATTATTTT
TTGATCTTTCTTTCTTACTTACTTACATTTATTTTGTTTGTAAACTTAAAAAATTTCATT
TATATTTGATTTAAGGGAAGAGAATGATTTGAAAACATTTTTTGAGAAGTATGGTGAAAT
TGTGAAAGTTTAAGTAATCAGAGACAAAAATAATTAGCACAAAGGGTGTGCTTTTGTTGT
TTTTGCCTCTATTTTATGCGCCAATATTGCAATTGAAGCTCTCAAAGCAACTAAATTGCC
TGGAGTATATTTGAAATTATATATAAATATATATACATATACATTTTTTCAACCAATATT
TTGTGAAAGAATAAATTCTATTGTTGAATGGCAAACCCATTTTCTATCAACATTTATTGA
AATTATGTTTTCAATAAATTAATTCATTCACTCATTAACTGTTTATTTATTTAAAATCCC
ATTTTTTTCAAAGGTTTGTAGGCAAACAATTTTTTTTTCAATTGTTTATTGAAAATCCAA
TTTTGTTTATATTTTTTTTATGGGCTTTTCGTTTTTTGTTTGTCAAGTTTTATTTGAAAC
TTACACACCAACCAACAATAAAAATGTTTTAATCCTTTTTAAGATGTAAAACAACATACA
GGTTAAGTGGGCTGATAATGAGCCTGATAGGCTAGGAATCAGACAAGACCAAGACTATGT
CTTATATGTAGCTCATATTCCTAAAAATGCATCAGAGGTGAGCTATTTATTTTTTCAAAC
TTTGAATTTATGCTCTATCTATTTTAAAAATAAATCAAGTGATATTTTTTACATTTATAT
AATACTAGCCTGAAATAAGAAATGTTTTTGAAAACTATGGAATTGTTAAAGAAGTTGATA
TCCCTAAAGATTAATCTGGAACAAGCAGAGGATTTGTTTTTGTGAAATTTGAAAATATTG
AACAAGCTATTTTAGCCAAATAGGCTCTCCATGAAAAATAAGTTTTAAATAATCAAACAC
AGTCCTTAGTGGTCAAGTTTTATGATCCTAAAAAGAAATAAACTCAAGGAAATTAAGGAC
CATAGTAAGGTCAATCTGGCAATTCTTCAAACAGTAAATGCTTTTTTTTTTTAAAGAGAT
AAATAAAATATATTATTTAAAAAAAATAGATTACAACAACAATGGACAGGGATAGCCTCA
TCACTCAAATAGGGATAACTAAGGACAGTCTAATTATTATCCATCTTCTTCATAGCCTTA
AATGTACTCATAAGGTTAATAGCCTAACCAAAGAAACTCTGACAATTATAATTACCAAAG
AGAATAGCACTCTAATTATAACTAAGGAAGCTAGTCATAAGGATATAGAGGAGGATAAGG
AAATTATCACGGGCATCATGAAAGCAAAGGGTCCTATAACTAAAATAATTAAAATTACCC
AAGAGAAAGTGCCAATTTAAACAACAGTGAACATTATGATTAGCCAAGCTAGTCGTTCGA
TAGCTTCTAAAGTCACTCTTCTAATTTTAGAGAGTAATATGGCAATCAAAATCTCCAATA
ATCATAACATAAGTAAATTTTTTATTTTTATTTTTAACTTGTAAAAAGTATTTAAGTATT
TTCATTTTTAATTAGTAACGGTTATCCTCACCATAATCGTAACAACAACAGCAACAACAA
TAACAGTAATAATAGCAGCAACAATAACTTTTAGTATAGCAGTAGCTACCCCTCTAATTA
GCCTGCTGGAAATAATTTGAGCAATTAGCAATTTAATTAAACTTATAATAACAGCAACTA
GAGTAATGACTATAACTACCAAAACCCTTAGTAAAACGACTATGTTCCTCCACCACAAGG
ACAAAATAACTTTTAGTTTAATGATTATTAACAGCAGCATCACAGTAATAATAATGGACC
TGTTCCAAATAGTGCTAATAATAATTAAATTTAATAGTTTAATCCATACTATAATAACGA
AAATTTTGATAACTATAACAATCCTTAGATTCACAACGAATAGCCCAGCTTTACTCCAAA
TTAACCTCCATAATAAATACCTTAACATGAAATAAATTAACCTCCATTATTCAATATGCC
ATAATAATAACAACAACCAATAAACCCATAGCCTTCATTAGACATTTCTTAGCCTAGTAG
TGGTTACTAAGAGCCAATCCCTGCTGTAGAACCTAATTAATAGCCAATTTAAGTAAAATC
TTTGTTTCCAATTAAATTATTTATTCTTTTTTATTTAATAGCAAAAAGCCTATATTAAGT
ATTACACTGATGACAAAGTCCCTTATTACTATGATACTCAAACTTAATCTACATCATATG
ACTAACCTCCTTTAGGATCGATAATATATAATCCAGATGGAACACAAGAACATGTATAAC
CAGAAAGCATCGAACAACTGCAAAAATTTTAACAAGAAACAGGATTAGCAGAAAATAAAG
AACTTGAAATTTTATGTAATAAAAAGTTTTTAATTAAAGTTAAATTAAATTAATTAATTA
AATTTTTTAAAGCCTAAAAAACAACAGGACCTCCAGGAGCTAATTTATTCATTTTCCATC
TTCCAAACGACTACCGTGATTCAGATCTTTTAAGACTCTTCAAAAAATTCGGTGATTTGC
TCTCCGCAAGAGTTATCACACGTCCTGATGGTTCTAGCAAAGGCTATGGTAAAAAAAAAA
ATTAAAATAAATTTAATTTAAACATTTAATTTTATTTGAACTAGGTTTTGTAAGTTATAC
AAGCCCAGATGGTGCTCAACAAGCTATACAGTAAATGAATGGCCTATAAGTTGGAAGTAA
ATAAAAATTAAAGTATGAGTTTTAAATTAAATATAATTTACATTAAATAGAGAAAAAGCT
AAAAGTAGAAGTAAAAAAAGGTCAAGGTGATGGAGATTTACCACCTAGTCTTAGTTAAAA
TGGATATTAACCCTTTTGA