Identifiers and Description

Gene Model Identifier

TTHERM_00136430

Standard Name

RRM2 (RNA Recognition Motif-containing protein 2)

Aliases

PreTt24368 | 10.m00417 | 3698.m00136

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02392 ) Ycf4
  • ( PF08777 ) RNA binding motif
  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00136430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05809.19.997093137033517e-262hypothetical protein (1293 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00136430(coding)
ATGAGTTAAATACCAGAAAAGGGAGAATACAATTCTATTTTGATTCACAACATACCAGAA
AATGTTACGAGAGAGGAGATTTAAAACTCCTTCAAAAAGTTTGGCACTATCAAGAATATA
TAAAGTTTTAAGCGCAAGAACTACACCATAAGAATAGAATATACAAATTCTGAAGATGCA
TAAAAAGCTATGAAAGAAATGAACTTTCACACTTTTTAAGGCGAAGAAATCAATATTCAA
TTCTTTTTAGATAAGGAGAAGAAGGAATAAATTAAGCATAACAATATTGTCATTAAGAAT
GTTCCTATTAATATCAGCTAAACAGACCTTTTTGAAGCTTTTAGCATGCACGGAGATATT
TTTTCTCTTTACCTCAAAAAAGGAGTAGATAAAGCAAATGTAGGAATAGGATATGTTTAA
TTCTTTAAAAATGCAGATAAAATCAAGATACTTGAATTGTAGGATTCATAAGGAGGCGAG
CTAACACTAAATCTGAAAAACGATACCGAAATTAAGCTAAAGCTTGAGGAATTCTATTCA
AAGAATGAAGAAGAGGCTATATTGATGTAAAAGTAGTAGCAATAATAGTAGATTTAACTA
TAACAACAATAATAAATTTCTTAAGGGTAGGTTGAGTAATCTTCAGGAGAACTAAAGATA
GAAGCCCAACCTGGAGTTTAAAATTTGACCATTCAGTCAGCACTAATACCATAAATTTAA
TAGCTTTAGCAAAATTCTTTGCAATAAAGTATAGCAAATTAGGTAAATAATACTCAATAG
CTCTAGCAATCTATCATTTAATAAACTCTTTCTCCCCAAGCTTTATAATTACCTAACTAA
TCTGATAATTCTTAAGCTTCTACTGCTGTTGTTGCGTCAAATATAGAATATGTTGTAATT
TTTATTAAAAATTTTATGGAAAAGGAAATTAGCACGTCTGAATCTAATGAGATAAGCTAA
GCTTTAAAAAATATAGAAATTAGCATTAAATAAGTTATTGAAAAAGTTTAAAATGAGCTC
AAAGGCAGTGCTCCTAAATTAGAATTTTATGTTTAATATAATGCACAGAAAAAAAATTTC
TGGAGTCATTTGTTTGGAGTGGGTACAGCTGATGTTTTTCAAAATATATTTGAAATTACT
TCTAAACTGCTCAAACAGACTTATCCTTCATGCGAAGTAAGCTTTAAGTAGAAAAAGAAA
TAGCAAGAACCATCAGCAAAGCATCTTATTTGTTTTGGAGTGAGACCAACTATAACTCAT
GAAAAAATAAAACAATGGCTCGAAGATCAGATTTTTAGTAGCCTAACTGTTTCATCTATA
AGCTTCAATTTAGTCAAAAAGAAAGAAAGTAGCACTTCAACTCAATCTTCAAAAAATTTT
GAAAAAGATTCATAAGTGCTCTACATCTTCTTTTTAAATGAATAAGAAGGCATTTAGTTT
ATGGAAATATGCAAAAAGAACTTAGCTCACACAAACAACATTTTTTATAAGCCAAAGATT
TCTTAATACCTAACAGATAAGCAAAGGTAAGATTTGAAAGCTAAAATGAATCAAAATAAT
TCTAACAATCTAGGCAGTTAAGGCTATTCAAGCAACCATTAAAATTACTAAAATCACCAC
TACCAATAGGGAAATTCAAACAACCATCACCAAGTATATCACCACAACAACGGCAACAAC
AACAATCACAATTATAACCACAATCACCACCATCACCATAATTATAATTAAAATAACCAC
TACAATCCTAATTAGCATCATTATTATACTAATAATAACAATTAAAATTAAACTAGCAAT
CATAATCATCATCATCATCATCACCACAACAATATAAATAATACTGCTTATCATAATAAT
AATCCCAGCTATCATAATAAAAACCAGTAGCATTCTTAGCAGGGAAATAGCCATAGCCAC
AATCACTATTAAGCTGGAAATCATCACTTCCATTAGGCTAATTTTAATTAATCTCATAAT
AGCAACCATCATAATGGAAATAACAGTCACCACAGCTAGCATTCTTAGCATCCCAATCAT
TAGTCTGGGTATAATAATTAGAATCAAGCTGGTTAATAGAGCAGGTAAAGAAATAGTAAA
TCTATGAATTATAGAACTAATTAAGCAGGAAATAACTCAAGTACTAACTATCAAGGAGGT
TAGAATTATTTAGGAACTAATGGGTAAAATAATGCTAGTTCAAGTTCAAGCTAATAAAAT
CAAAGTAACCAAACTAATCAACAGCAAAGAGGTAGCTAAAATATTAGCTCCTCACAATAA
AACAATCAATATAATTATGGATAAGGAAATAGTCAAAATAATTAAATGCAGTAAAGAAAT
ACCGCATACGCTTAGCATAGATCATAGATTAATAATTAAAATAACTCATAATAAAGTGTT
CACTAAGGTACAAAGAATATACCAAGCAACTACACATAGCACCACTAAAAGAATTAAGGC
ATGCAAAATGAAAATACTAGAAATAATAGAACTAGAAATTAGAACAATCAGCATAGCATG
AACAGTAATCATCACAGCCACATTGCAAATAGTCAATAAGGAAATAACAATTAAAATAAT
TATCATAACAATAGTTAATCATATGCTTCATCTGGAAATTCTTTCTTACCTAATTATGCT
AATAACCATTAACGTATTGATTAATATTCTTAGAGTGCTAATATTCATAATAGCAATAAC
AATCGTAGGTCACAAAACAATAATGTGAATAGCAGTAATTTGAGCTCTGGAAATAATAAC
AATTTTGATAATAATAATAACAAACAAAATTTCACAAATAGCAAAAGTGAGACTAATAAC
AGCTACACTAGCACTTCAAGTTAAGGAACTGCCTAAATATATGTTTAGAAAAATTAATAA
AATTCTAATAATAGCAATGGCAATAAGCACTTCAATGGCTCTAGCAGTGGATTAAATAAT
TCTTATAGTAGTTTTACATCTCCTCCTTAAGGAAACAGAGTAAATAACGCTAATAACACT
CAAGGAGGTACTTTGAATACATTTGATACATTCCCTAGTAATCATATTACTTAAAATACC
AACTCATTTGGAAATATTGGAAGAGGTACTAATAGTAGTAATTTCCATAACACAAATTCA
TCTACAAACTAAACAGTAGCATAATAATAAAATTACTCAAATAATACTAATAATTAGTAA
TACTTTTAAGCCAATAGCAATAAGAACTAAAATTATTTTAGTCCTCTAGGCGTGAACAGC
TAATCTCAATAATAGAATTAAGTTGGATAAGCTAATGGAAGCATCTAAAATAAATCTACC
AATTACTTGGTAAATATTTCTTCAAACAACCTGATTGTAAATCCCAATAACTCAACTGCC
AACACGACAGCTACAGCATCTCCAACTACTGCTTCGTCATAAAATGTAGTAAATTCAATG
TCTAGTAATGCATTTACATCATCTCTGAGTAGCTATATAATAGCTTTGAGCAACGCAAAT
ACTCAGCAAGTATAGCAAAATGTAATTGAAAACCTTAGAAATGAAGTTCTAAATAACAAA
GTAGAATTTAAGGCTCTTTAGGATAAAGATTTAAAAAATAAAACTATTTCATATATAATT
AAATAAATGATTATCAATTTATCAAGCGCTGAAGAAAAGGTAGGCTAATTACTCCAAATC
AAAGAAAGTGATAAAATCAAAGCAAAAGTAGAACATTTTATTTCAATTAATGAGTAAATA
TGCCAGCTTTTCACAAATTGTGTATTTAGCACTGACGAGATTCTGCAAATAATCGAAGAT
TAAAATTAACTTGTTCAAAAATGTGAATATTTCACAAAGCTAAAAACATCTTGA


>TTHERM_00136430(protein)
MSQIPEKGEYNSILIHNIPENVTREEIQNSFKKFGTIKNIQSFKRKNYTIRIEYTNSEDA
QKAMKEMNFHTFQGEEINIQFFLDKEKKEQIKHNNIVIKNVPINISQTDLFEAFSMHGDI
FSLYLKKGVDKANVGIGYVQFFKNADKIKILELQDSQGGELTLNLKNDTEIKLKLEEFYS
KNEEEAILMQKQQQQQQIQLQQQQQISQGQVEQSSGELKIEAQPGVQNLTIQSALIPQIQ
QLQQNSLQQSIANQVNNTQQLQQSIIQQTLSPQALQLPNQSDNSQASTAVVASNIEYVVI
FIKNFMEKEISTSESNEISQALKNIEISIKQVIEKVQNELKGSAPKLEFYVQYNAQKKNF
WSHLFGVGTADVFQNIFEITSKLLKQTYPSCEVSFKQKKKQQEPSAKHLICFGVRPTITH
EKIKQWLEDQIFSSLTVSSISFNLVKKKESSTSTQSSKNFEKDSQVLYIFFLNEQEGIQF
MEICKKNLAHTNNIFYKPKISQYLTDKQRQDLKAKMNQNNSNNLGSQGYSSNHQNYQNHH
YQQGNSNNHHQVYHHNNGNNNNHNYNHNHHHHHNYNQNNHYNPNQHHYYTNNNNQNQTSN
HNHHHHHHHNNINNTAYHNNNPSYHNKNQQHSQQGNSHSHNHYQAGNHHFHQANFNQSHN
SNHHNGNNSHHSQHSQHPNHQSGYNNQNQAGQQSRQRNSKSMNYRTNQAGNNSSTNYQGG
QNYLGTNGQNNASSSSSQQNQSNQTNQQQRGSQNISSSQQNNQYNYGQGNSQNNQMQQRN
TAYAQHRSQINNQNNSQQSVHQGTKNIPSNYTQHHQKNQGMQNENTRNNRTRNQNNQHSM
NSNHHSHIANSQQGNNNQNNYHNNSQSYASSGNSFLPNYANNHQRIDQYSQSANIHNSNN
NRRSQNNNVNSSNLSSGNNNNFDNNNNKQNFTNSKSETNNSYTSTSSQGTAQIYVQKNQQ
NSNNSNGNKHFNGSSSGLNNSYSSFTSPPQGNRVNNANNTQGGTLNTFDTFPSNHITQNT
NSFGNIGRGTNSSNFHNTNSSTNQTVAQQQNYSNNTNNQQYFQANSNKNQNYFSPLGVNS
QSQQQNQVGQANGSIQNKSTNYLVNISSNNLIVNPNNSTANTTATASPTTASSQNVVNSM
SSNAFTSSLSSYIIALSNANTQQVQQNVIENLRNEVLNNKVEFKALQDKDLKNKTISYII
KQMIINLSSAEEKVGQLLQIKESDKIKAKVEHFISINEQICQLFTNCVFSTDEILQIIED
QNQLVQKCEYFTKLKTS


>TTHERM_00136430(gene)
AAAAAAAAAACACACACAAAAATCAAAAATAGTAAGAAGAAATACGAAATCATTATCAAT
AACAGTATAAAATCTTAAAAAATTATATTTGTAAAAAACTTAGATTATCTTTTTAAAAGA
AAGAAAATAATATAAGTTAGGAAAAAGAAGTGGAGAGCAAAACCAATAAATTATTACTAC
TATTCAATAATAAAAGAGCAAAATGAGTTAAATACCAGAAAAGGGAGAATACAATTCTAT
TTTGATTCACAACATACCAGAAAATGTTACGAGAGAGGAGATTTAAAACTCCTTCAAAAA
GTTTGGCACTATCAAGAATATATAAAGTTTTAAGCGCAAGAACTACACCATAAGAATAGA
ATATACAAATTCTGAAGATGCATAAAAAGCTATGAAAGAAATGAACTTTCACACTTTTTA
AGGCGAAGAAATCAATATTCAATTCTTTTTAGATAAGGAGAAGAAGGAATAAATTAAGCA
TAACAATATTGTCATTAAGAATGTTCCTATTAATATCAGCTAAACAGACCTTTTTGAAGC
TTTTAGCATGCACGGAGATATTTTTTCTCTTTACCTCAAAAAAGGAGTAGATAAAGCAAA
TGTAGGAATAGGATATGTTTAATTCTTTAAAAATGCAGATAAAATCAAGATACTTGAATT
GTAGGATTCATAAGGAGGCGAGCTAACACTAAATCTGAAAAACGATACCGAAATTAAGCT
AAAGCTTGAGGAATTCTATTCAAAGAATGAAGAAGAGGCTATATTGATGTAAAAGTAGTA
GCAATAATAGTAGATTTAACTATAACAACAATAATAAATTTCTTAAGGGTAGGTTGAGTA
ATCTTCAGGAGAACTAAAGATAGAAGCCCAACCTGGAGTTTAAAATTTGACCATTCAGTC
AGCACTAATACCATAAATTTAATAGCTTTAGCAAAATTCTTTGCAATAAAGTATAGCAAA
TTAGGTAAATAATACTCAATAGCTCTAGCAATCTATCATTTAATAAACTCTTTCTCCCCA
AGCTTTATAATTACCTAACTAATCTGATAATTCTTAAGCTTCTACTGCTGTTGTTGCGTC
AAATATAGAATATGTTGTAATTTTTATTAAAAATTTTATGGAAAAGGAAATTAGCACGTC
TGAATCTAATGAGATAAGCTAAGCTTTAAAAAATATAGAAATTAGCATTAAATAAGTTAT
TGAAAAAGTTTAAAATGAGCTCAAAGGCAGTGCTCCTAAATTAGAATTTTATGTTTAATA
TAATGCACAGAAAAAAAATTTCTGGAGTCATTTGTTTGGAGTGGGTACAGCTGATGTTTT
TCAAAATATATTTGAAATTACTTCTAAACTGCTCAAACAGACTTATCCTTCATGCGAAGT
AAGCTTTAAGTAGAAAAAGAAATAGCAAGAACCATCAGCAAAGCATCTTATTTGTTTTGG
AGTGAGACCAACTATAACTCATGAAAAAATAAAACAATGGCTCGAAGATCAGATTTTTAG
TAGCCTAACTGTTTCATCTATAAGCTTCAATTTAGTCAAAAAGAAAGAAAGTAGCACTTC
AACTCAATCTTCAAAAAATTTTGAAAAAGATTCATAAGTGCTCTACATCTTCTTTTTAAA
TGAATAAGAAGGCATTTAGTTTATGGAAATATGCAAAAAGAACTTAGCTCACACAAACAA
CATTTTTTATAAGCCAAAGATTTCTTAATACCTAACAGATAAGCAAAGGTAAGATTTGAA
AGCTAAAATGAATCAAAATAATTCTAACAATCTAGGCAGTTAAGGCTATTCAAGCAACCA
TTAAAATTACTAAAATCACCACTACCAATAGGGAAATTCAAACAACCATCACCAAGTATA
TCACCACAACAACGGCAACAACAACAATCACAATTATAACCACAATCACCACCATCACCA
TAATTATAATTAAAATAACCACTACAATCCTAATTAGCATCATTATTATACTAATAATAA
CAATTAAAATTAAACTAGCAATCATAATCATCATCATCATCATCACCACAACAATATAAA
TAATACTGCTTATCATAATAATAATCCCAGCTATCATAATAAAAACCAGTAGCATTCTTA
GCAGGGAAATAGCCATAGCCACAATCACTATTAAGCTGGAAATCATCACTTCCATTAGGC
TAATTTTAATTAATCTCATAATAGCAACCATCATAATGGAAATAACAGTCACCACAGCTA
GCATTCTTAGCATCCCAATCATTAGTCTGGGTATAATAATTAGAATCAAGCTGGTTAATA
GAGCAGGTAAAGAAATAGTAAATCTATGAATTATAGAACTAATTAAGCAGGAAATAACTC
AAGTACTAACTATCAAGGAGGTTAGAATTATTTAGGAACTAATGGGTAAAATAATGCTAG
TTCAAGTTCAAGCTAATAAAATCAAAGTAACCAAACTAATCAACAGCAAAGAGGTAGCTA
AAATATTAGCTCCTCACAATAAAACAATCAATATAATTATGGATAAGGAAATAGTCAAAA
TAATTAAATGCAGTAAAGAAATACCGCATACGCTTAGCATAGATCATAGATTAATAATTA
AAATAACTCATAATAAAGTGTTCACTAAGGTACAAAGAATATACCAAGCAACTACACATA
GCACCACTAAAAGAATTAAGGCATGCAAAATGAAAATACTAGAAATAATAGAACTAGAAA
TTAGAACAATCAGCATAGCATGAACAGTAATCATCACAGCCACATTGCAAATAGTCAATA
AGGAAATAACAATTAAAATAATTATCATAACAATAGTTAATCATATGCTTCATCTGGAAA
TTCTTTCTTACCTAATTATGCTAATAACCATTAACGTATTGATTAATATTCTTAGAGTGC
TAATATTCATAATAGCAATAACAATCGTAGGTCACAAAACAATAATGTGAATAGCAGTAA
TTTGAGCTCTGGAAATAATAACAATTTTGATAATAATAATAACAAACAAAATTTCACAAA
TAGCAAAAGTGAGACTAATAACAGCTACACTAGCACTTCAAGTTAAGGAACTGCCTAAAT
ATATGTTTAGAAAAATTAATAAAATTCTAATAATAGCAATGGCAATAAGCACTTCAATGG
CTCTAGCAGTGGATTAAATAATTCTTATAGTAGTTTTACATCTCCTCCTTAAGGAAACAG
AGTAAATAACGCTAATAACACTCAAGGAGGTACTTTGAATACATTTGATACATTCCCTAG
TAATCATATTACTTAAAATACCAACTCATTTGGAAATATTGGAAGAGGTACTAATAGTAG
TAATTTCCATAACACAAATTCATCTACAAACTAAACAGTAGCATAATAATAAAATTACTC
AAATAATACTAATAATTAGTAATACTTTTAAGCCAATAGCAATAAGAACTAAAATTATTT
TAGTCCTCTAGGCGTGAACAGCTAATCTCAATAATAGAATTAAGTTGGATAAGCTAATGG
AAGCATCTAAAATAAATCTACCAATTACTTGGTAAATATTTCTTCAAACAACCTGATTGT
AAATCCCAATAACTCAACTGCCAACACGACAGCTACAGCATCTCCAACTACTGCTTCGTC
ATAAAATGTAGTAAATTCAATGTCTAGTAATGCATTTACATCATCTCTGAGTAGCTATAT
AATAGCTTTGAGCAACGCAAATACTCAGCAAGTATAGCAAAATGTAATTGAAAACCTTAG
AAATGAAGTTCTAAATAACAAAGTAGAATTTAAGGCTCTTTAGGATAAAGATTTAAAAAA
TAAAACTATTTCATATATAATTAAATAAATGATTATCAATTTATCAAGCGCTGAAGAAAA
GGTAGGCTAATTACTCCAAATCAAAGAAAGTGATAAAATCAAAGCAAAAGTAGAACATTT
TATTTCAATTAATGAGTAAATATGCCAGCTTTTCACAAATTGTGTATTTAGCACTGACGA
GATTCTGCAAATAATCGAAGATTAAAATTAACTTGTTCAAAAATGTGAATATTTCACAAA
GCTAAAAACATCTTGA