Identifiers and Description

Gene Model Identifier

TTHERM_00421000

Standard Name

RRM18 (RNA Recognition Motif-containing protein 18)

Aliases

PreTt07225 | 46.m00280 | 3679.m00130

Description

RRM18 RNA-binding family CELF1 RNA recognition motif 3 in CELF/bruno-like protein; RNA recognition motif-containing protein; 2014 reannotation incorporated RRM19 (TTHERM_00421010) into this gene model

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08777 ) RNA binding motif
  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( TIGR01659 ) sex-lethal family splicing factor
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00421000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10974.19.997093137033517e-262hypothetical protein (307 aa)
DictyBaseDDB_G02706342.9990874792167046e-33DDB_G0270634 on chromosome: 1
position 3530459 to 3532109
WormBaseWBGene000068078.999890565246037e-26locus:unc-75 status:Confirme
d UniProt:G5EE68 protein_i
d:CAB03896.4
OxytrichaContig18677.0.g109.997019043202629e-21RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
SGDYER165W3.001003044337619e-17PAB1 Poly(A) binding protein,
part of the 3-end RNA-processi
ng complex, mediates interacti
ons between the 5 cap structur
e and the 3 mRNA poly(A) tail,
involved in control of poly(A
) tail length, interacts with
translation factor eIF-4G
Stentor CoeruleusSteCoe_204596.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00421000(coding)
ATGAATACCAACGAATACATAGACTAATTCGATTAAAATAAAAATATGGGAGCTTATTAC
GATAGCAATGGTTATGCTATGTAAAACTAGTAATAAATGGATTAAACCTACCAAAACCCT
CAAAACGAAATTAAGGAAGGTGGTGATCTACTTAAAATTAACAATACTTAAATTTTGATC
CGTAGATAGGAAAATACAGTCGATTTAAAACTCTTTGTCGGTTAACTACCAAAGACATGG
GAAAAAGAGCAAGTTAAAGATTTCTTTTCTAAATTCGGCAGAATTTATGAAGTTTAGATT
ATTAGAGACAATAAGGGATAACACAAGGGTTGCGCTTTTGTTAAATTTGCTTCAATGACT
GACGCAGAAAAAGCTATTGAAGCTGTAAAAAACACCACCTTTCCAGGAATGAAGAATAAC
GTTGAAATTAAATGGGCTGACAACGAAGAAGAAAGACTTGGTGTCAACTAAGACTCTGAC
CATAAATTATTTATTGGTTCTCTTCCTAAGTCTTGCACTGAATAAAATATTAAAGATATC
TTTGAATTTTTTGGTGAAATTGAAGAATTACACCTTATGAAGGATAACTAGTAAAACACA
AGATAAGCATTTTTAAAATTCAAACAAAAAGAAAAAGCTCACCTTGCTATCAGAAACTTA
AACTCTCAAGTCTACATCAATGATGCTGAAAATCCAATTGAAGTTAGATTCGCTAAGAAA
TATGTTAAGCAAGAAAAGCCAAATCCTACTCCAGCTCCTAAACCTGACCCTGCTCCTGCT
CCTTAGCAAATCAGCTGGTAAAAAGTATACTTCAAATACTACACTGAAGAGAATGAACCT
TACTACTTCCATCCTCTTCTAAATACTAGTGCCTTTGACAAACCTGGTCCTGGAAGCTTG
ATTTTAGATATTGATGGAAATCAAGAATACATAGATAACAACCCTAGACCTACAAGAAAC
GAACCTGTTGTTATTAATGATAGAAAGGATGTTTATGGCAAAAAGCATGGACCTCCTGGA
GCCAATCTTTTTATATTCCACTTGCCCAATGACTACAGAGATTCCGATTTAGAAAAACTC
TTTTCAGAATATGGTGAGGTAATTTCTGCTAGAGTCAATACAAGACCTGATGGAACAAGC
AAAGGATTTGGTTTCATTAGTTATAACCACCCATCTTAGGCAGAGGCTGCAATCACTGCT
CTCAACGGACTCTAGATTAAAAATAAGAGACTAAAAGTTGAAATAAAAAAAGAAGGAATG
GATAACAATGGAAACATGAAGCAATCCAACCCTGGATCTTTAAACCAAACTTCTTTCCAT
CCATTCTGA


>TTHERM_00421000(protein)
MNTNEYIDQFDQNKNMGAYYDSNGYAMQNQQQMDQTYQNPQNEIKEGGDLLKINNTQILI
RRQENTVDLKLFVGQLPKTWEKEQVKDFFSKFGRIYEVQIIRDNKGQHKGCAFVKFASMT
DAEKAIEAVKNTTFPGMKNNVEIKWADNEEERLGVNQDSDHKLFIGSLPKSCTEQNIKDI
FEFFGEIEELHLMKDNQQNTRQAFLKFKQKEKAHLAIRNLNSQVYINDAENPIEVRFAKK
YVKQEKPNPTPAPKPDPAPAPQQISWQKVYFKYYTEENEPYYFHPLLNTSAFDKPGPGSL
ILDIDGNQEYIDNNPRPTRNEPVVINDRKDVYGKKHGPPGANLFIFHLPNDYRDSDLEKL
FSEYGEVISARVNTRPDGTSKGFGFISYNHPSQAEAAITALNGLQIKNKRLKVEIKKEGM
DNNGNMKQSNPGSLNQTSFHPF


>TTHERM_00421000(gene)
ATGAATACCAACGAATACATAGACTAATTCGATTGTAAATAATGAAATTAAAAAAAAATT
TCTAACTTTAATTTACTTAACCTATGAGGAGAATTATCTTAAATATGTTTTATAATTATC
AAATTACATAGAAAATAAAAATATGGGAGCTTATTACGATAGCAATGGTTATGCTATGTA
AAACTAGTAATAAATGGATTAAACCTACCAAAACCCTCAAAACGAAATTAAGGAAGGTGG
TGATCTACTTAAAATTAACAATGTAAATTACTTAGCACTTTAATTTCTCTTTATTTATTT
TAATGGACTGTATGATAGAATTATAATAACACACACACACATTAAAATCTTAATAAGAAA
AAAATAATGATCATATAGACCATCTTACAAATAAAAAACTGAGAATAATTTTATTATTTT
TAATTAAATAGACTTAAATTTTGATCCGTAGATAGGAAAATACAGTCGATTTAAAACTCT
TTGTCGGTTAACTACCAAAGACATGGTAAAAATAAAATTAGTAAAAGTTAAGTATTTATT
GACTCAATTTTTAAATAGGGAAAAAGAGCAAGTTAAAGATTTCTTTTCTAAATTCGGCAG
AATTTATGAAGTTTAGATTATTAGAGACAATAAGGGATAACACAAGGGTTGCGCTTTTGT
TAAATTTGCTTCAATGACTGACGCAGAAAAAGCTATTGAAGCTGTAAAAAACACCACCTT
TCCAGGAGTAAATATTAATAAAATAGATTTTTAGACAAATTTATTTATTCTTATAAAATT
AACTAGCAATATATATCTATCTATCTATACATTTATACATCTATTAATTCATTAATTTCT
TAATTAATTTTCTTTTAAATTTTTAATTTCATTAGATGAAGAATAACGTTGAAATTAAAT
GGGCTGACAACGAAGAAGAAAGACTTGGTGTCAACTAAGACTCTGACCATAAATTATTTA
TTGGTTCTCTTCCTAAGTCTTGCACTGAAGTAATAAAATTTAGGACTAAGATTTAAGGTT
TTTAAATATAATATTTTAATAGTAAAATATTAAAGATATCTTTGAATTTTTTGGTGAAAT
TGAAGAATTACACCTTATGAAGGATAACTAGTAAAACACAAGATAAGCATTTTTAAAATT
CAAACAAAAAGAAAAAGCTCACCTTGCTATCAGAAACTTAAACTCTCAAGTCTACATCAA
TGATGCTGAAAATCCAATTGAAGTTAGATTCGCTAAGAAATATGTTAAGCAAGAAAAGCC
AGTAAAATTTTTTATTTAAAATATTTTTTATTTTAGTGATCAAAGCGGCTTAAAGATTGC
CGAATAAGGGTGGGTTTGATTGATCATGTGAAAAGGTAAGTTAAAAAAAAGTAATAAGGA
AATTTTATTTGTTTATTGATGGATAAAATTGGTTAGCCTTGTGAAATTCTAAATCTAAGT
TCTAGATAGATAAATGATCAATCTTTGAATCATAATAAGATAACTAAAAGTGAGGGCATC
ATTAATAACAATCAATCAAGCAAGTAAGCAGCAAGCAAACAAAAAAAAACACAACAGAAA
ATAGAATCAAAGTCTAACATTAGAAAGAAAGAAATCAAATTAACAAAATAACTAAGTAAC
TAAGTTACTAACTAACTAACTAACTAACTAATTAACTAATAACAATCAAACAACTGATCA
ACCAAAAAATTAGAGAGGATGAAGTAGATTGAAACGAAAAAGAGATGAATCTCGTCTTAT
TAGAAATAAAATAAAAGCAAGTTATCTATAATTAATAGAATAAATTAATAAATAATTAAA
ATATTATTATGAGTAAGTAGTCTACATAATCTAATAGTAAGTATGTGATCGCATGTATCG
TGTAAATTAATGTTGTAGTTGTTGTTTAAATAATAAAATAGTAATAAATTATGTTGTTGT
TATTGATGTTCCATCTTGTTATAATTACTTAAAAGCTAAATTATCAAAATCCCTGTTTAC
TAACAAACAAACAAACTAATTAACTAATAAGATCATATATCATCTATCTATCTATCTCAA
TCAATCATAAACAAACTACTTAAACACATGCATCAATCGATTTGTCTAATAGTTATATAT
TATCTATTCAACAAAAAAAAAATAAAAGCAATTTTACAGCTTTTCAAACCAATTCTTTTA
ATATTTTCATTTATCAAACTAAATTTAAAATTCAAAAATAAATAAAAACTTTATTTTTTT
AAATACAGAATCCTACTCCAGCTCCTAAACCTGACCCTGCTCCTGCTCCTTAGCAAATCA
GCGTAAGGATATTTAATCAAAAAATTTAATTTTTAAGTTTTAAAATTTAAAATTTAGTGG
TAAAAAGTATACTTCAAATACTACACTGAAGAGAATGAACCTTACTACTTCCATCCTCTT
CTAAATACTAGTGCCTTTGACAAACCTGGTCCTGGAAGCTTGATTTTAGATATTGATGGA
AATCAAGAATACATAGATAACAACCCTAGACCTACAAGAAACGAACCTGTTGTTATTAAT
GATAGAAAGGATGTTTGTAAATATATTTCAAAATTTTAAATTAATAAAATAAAAATTAAA
AAATTAATTCACTTCCTAAAATAAAACATTTCATTTTTTATTTTTTTTAAACTTACTTTT
TAAACTAAATATTAAATTATTTTTATTAAAATAGATGGTAAAATATTATTTAGATGATTC
TGATTGCACAACATAGTTTTTATTTACAAGCTAATTATCTAAATCATTTATTTTACTTTT
TTCTATTAAAATTAATAGATGGCAAAAAGCATGGACCTCCTGGAGCCAATCTTTTTATAT
TCCACTTGCCCAATGACTACAGAGATTCCGATTTAGAAAAACTCTTTTCAGAATATGGTG
AGGTAATTTCTGCTAGAGTCAATACAAGACCTGATGGAACAAGCAAAGGATTTGGTAAAT
ATTGAAGCTCTTTAAGTTAATTTTTAATGCTTAAATTATTTTAGGTTTCATTAGTTATAA
CCACCCATCTTAGGCAGAGGCTGCAATCACTGCTCTCAACGGACTCTAGATTAAAAGTAA
ATAAAATATTAGAGTAAATATAAAATATAAATAAATTTTAATATAAATAGATAAGAGACT
AAAAGTTGAAATAAAAAAAGAAGGAATGGATAACAATGGAAACATGAAGCAATCCAACCC
TGGATCTTTAAACCAAACTTCTTTCCATCCATTCTGA