Identifiers and Description

Gene Model Identifier

TTHERM_00419990

Standard Name

RRM17 (RNA recognition motif-containing protein 17)

Aliases

PreTt07124 | 46.m00179 | 3679.m00029

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00419990

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11068.19.997093137033517e-262hypothetical protein (1418 aa)
WormBaseWBGene000209360.00000000030007160092483236locus:hrpf-1 status:Confirme
d UniProt:Q9BIB7 protein_i
d:CCD68995.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00419990(coding)
ATGAATGTGACATATAACTCTCATAGTAGCACCAACAATACAGGAAATTTTATGTCTTTA
GGGAATTAAAATCCTCAATAAAATAATTTTTACCATAATGGCTTGACTTCAAATACTTAA
TCTCATTATATGGGCTCATAATCAATACTCGGCCAAACATAACCCCCTTTTTATTAAAAT
AATTCAGGATATATACATCCATCAGGATTGTAAGGCATCTCAAATATAAATTCAACATAA
GCAAATATGCTTAATCAAAATTTGAGTCTTACTCTAAATGGCATCATTAACACTCAATCT
GCAATGAATAATTAAATTTCTTAACCTCCTTAGATTATTTAATATCCTATTTACGATCAT
TTTATAATAATTGAATGTGGCTTTGATGATTAGCCTTAATCTGGTTCTCAAATGCGTATT
GAAGATGCTGTTTCACCCTCTGCTTAAAATACATCTAATCTGAATAGTCTTAATGCTTAG
CCCAATTCTTCCTAAAGCAATAACAATAATAATTTAAATAATGTAATTAGTTGTTCACAA
AATATTATTCGTGATATGCATTGGGGAGTATACAGCGTGAAAGAAAGGAGACTTATTAAA
GATTAATATTATGATTTTTCCAATCTAGACAATAAAGCTATCGTATAATCATCTGATTCA
TTTACATCTAGTGCAGCTGCTGCCACCTAACAAATCGAAGATGTTGGAGTTATACCTGCT
TCAGCACTTCCTGGAAGAAGGAATTCAAACTAAAAGTTAGAAAAATCCCCTTCTGCTCTA
AGCTCTAGTGGAAAAAGCGGGAAAAAGCCGAATCCTCTCAGCCCCCTCTACACTTCCGTG
GCTAATGCTCTAAACACATTAATAGATTTTATAGATAAAGAGATTACTTCAAAATAATTA
AAATTTGTTACAGTTTTAAACAGTGAAACTATGAACCCTAATATATTGCCACGTTTGATT
GAAGAAAGCAAAGTCTCTTCAAAAGGATTTTTTGAATATTATTATTTTTTATAAAAAGAA
TGCAGTGATGTTTTTAATGTTAAACCTTAAGAATTTACTTCAATAGGCTCTATCATGCAA
TATTTATCATTAAGAGAGAAACAGGATAATGTTTCCACCAAGAGTTTATTTAAATGCATG
TCTAAGCTACTTACTCTCATTCTAGCTGCTGATCATAAATTTACCAGTTAGCCTTTACGT
AATAATAAATTAGCTTTGGGTTATACATCTTCTTCATAAAATACTCCACCTTAGGTTAAT
CCTCAAAACATTCACTCCTTCAAAGGCAATAATCATTCATATAATTTTCTTAATTCAGGA
GCCTCCCTTTCTACGGGCTTTGGTGCAGCATAAAATATGTATTCAAATAATTTCTCCTAG
CAGGCTGCTTCTAATCACATCTATTAGACAGGAGGTAATTTTTTTGTTGGCTCTACGAAA
AGTGTTCCTCCACCAAATAATTCAACTTAAAATAATACCTCCAATCAAACTCAATAGCAG
TCGTATAGTCATTCCCTTATACTGCCGCTGGGAGGAACTAGTAATCGTAAGAGCATAGAT
ATTAGTAATTACCCTAATCCTTATGGCAACAATCAGCAATAATTTAATCTTGTATAGCAG
GGAAATACTGGTTCAAGCACAAATATAATTGACCTGAGCTCAGATCCCTCTTTGTAAGAA
GAAGTAAAAGGCTAGCATAAGGAATAAATAAAAGAAATAACACCTTTCAGTTAATCTTCC
TAATCTCACTCTTAGTAGACAAATTAAAATACTTTATCTCAGTAAGCTGCAACATAAAAT
GCATCTAATTTAGGTTCTTTGATGGAGGGATTAAAGAGCAGTGGATAAAATTCCAATCTA
AACTCATCATAAGTAATTAATGCCTCTCTCACTAATACATAATCAAATGGTGTAGGAAAT
TCATCGGCTGTATAAAATTAACAGAATAACTCATCACATAATAGTCAAGCAATTGAAAAG
GATAAATCCCGCTCTAAATCAAAACAGTATAATAAAAAAGAAGAAAAAAGCCACAGCAAA
AGCAGATATCGCTACTCTAGTAGGCGAAAGAGTAATTCAAGAGATAACAGCAGCAGTCAT
TAATAAGAAATGAACAAAAAGAGAAGAAGTAGCTACTCTTCTTAACGCTCGCCAAGTTCA
TCAATTCGCAGATAGCACAACTAATCTTCTAATTAAGCTAGTTTGTACAATCCTAAAAGT
AGAAACGAAAACAATAATCCCTATTATAAGAACAGAAAAGGCTACATTCCTTATAATGCC
TACAATAATCGTAAGAATTATAACCAAAAAAGTGCATCAAGTTCTAGCAAAAGCAACAGC
AGAAGTCGTAGTCATAGCCATAGTCGTAGTCGCAGCCGTAGTAGTAGAAGTAAAACTAGC
AGCAGCATAAGCAGTAGAGTAGAATAAAACAGATTTAACTATAGAAAGGGAAATGGCAGT
AAATCTCCATCTCAACAAAATAAAAGAGATTTTTATAAGGGAGGCAACAATAATAATTAT
TACAACAAGAATAAACATTTTAAAAAGTATGACAACTACAAGAGAAGAAATAGCTAAAGC
AACGAAAGAGGAGGATACCAATATGGTAGGTACTAAAATTATCGACATGATCACTATTAA
AACAATAGATCTTACAACAATGGGCCAGATGGTGAGTACGGCAGCAGTAATTATAATAGG
AAAGGTGATAGTAGAGAAAGATATCCACCATCTACACTAAATAAACGAGCTTCTGTATCT
AAAAGTCACTCTGCAGGAAGAGGCAGCATTTAAAGGTAGAACAACAACAATATGTATGGA
GGAAACCAACAATCTTAAAATCCTTACAACTCATAGTCTAAATACAATTAATATTACTAC
TACCTCAAATTCAAAGACCTTCCTAATTGCAGCAAGCAAGACTTATACAATTTCATAAAA
AATAATTCAAATGTTAGAGTGTACAAAGAAAATATTTTCTTGTTAGCTGACAAATATGAT
AATTTTAGTGGAGAGGCCTACATTCGCTTAGAAAAAGAAAGAGATGCAAATGATTTGTAG
TATTTAAGCGGAAAGGAGTTTGATCTCAAAAAAATTTCAATAGATAAGAGTTCACATGAT
AGCTTTAAAAGAAAAAATATATTCCATGAGAGTGTAAGTTCAAATAGCAATTCGCCAAAC
AGATATTAAGGCACTTAGAATAAATACTAGTCCAACACTTAGCAACATAATTCATATTAA
AATTAAGATAAATTGAAATAAAATAATAGCAGAGATAAATCTTAAAATCGTACTAAATCT
TCCTCAAAAAGAAAGGAGGCACAAAATGCATCTTCTTCCTCTTCATCATCATCTTCGTCT
TCCTCCTCCTCATCGTCTTCCTCCTCTTCAAATAAATCAGAAGCTTCTGATAAATAAAAG
CCCTAAGAAAGATAAAAGGATTAGGAAGAAAACACGAACAAAAATGATAGTACCAACAAT
AAAAGCTAATAAGAAAATATCAATGATAATAGCAATAAAATTAGCAAAAGTCCAAGCTAA
GCCAAATAAAACACTACTGCAAACAACAATTAGTAAAATAAATATTTAGAAGTTAAAGAG
TAAAATAACAATAACAATAATAACAATATAAATTCTAGCAGTAACAACAACAACAACAAT
AATAATAAATTAAGTAATAGCAGCAGCAATTAATATTAAAATATTCAAAACAAATATCAA
AAGCACAATCGATATGATAGAAGTAGAAGTGCTAGTAGAAGAAGCAGAAGTAGCAGCTAA
TTTGATCGCAGATCTTCATCAGCAAATAAGCCTATTGATTTTAAAAGCAAAAGAGTTCTA
TAATAATATGGAATACTTCGTATAAGAGGATTACCTTATTCATGTAAGACGAAGGAAATT
TATGAATTCTTTAAAGATTTTGAAATTGTACAAGATGGTGTTAAAAGAGTTTATAATTAT
TAAGAATAAAAGCAAACAGGAGAAAGCTTTATAATATTAAAAAATAAAGATTAAGTAAGA
GAAGCTAAGTAAAAACTTCATGGAGAGAGAATTTTTCAAAGGTATATAGAAGTTTTTCAA
TCAGATCCTAATGAATTCCTAGATTATTTAATAGATAAAATCTTACCTCAAAGTATAAGT
AGCAAAAACAATCGTAATCGCTATAACAATTTTGAAAATAGAAAAAATTTCAACAATCTA
AATAATAATAATAATAACAACAACAACAATAATAGATATAATTAAGATCGCCCATTCTAC
TATGATAAAAATGAAAGAAATTATTCGAATCCTCATAATAACAACAACAATAACAATAGC
AATAATGGAGATGCAAATAAGTTTAGAAATAAAAAATATTAAGACAAGCACAGTAGAGAT
GATGAAAGTAGTGAGCTTGATTATTGA


>TTHERM_00419990(protein)
MNVTYNSHSSTNNTGNFMSLGNQNPQQNNFYHNGLTSNTQSHYMGSQSILGQTQPPFYQN
NSGYIHPSGLQGISNINSTQANMLNQNLSLTLNGIINTQSAMNNQISQPPQIIQYPIYDH
FIIIECGFDDQPQSGSQMRIEDAVSPSAQNTSNLNSLNAQPNSSQSNNNNNLNNVISCSQ
NIIRDMHWGVYSVKERRLIKDQYYDFSNLDNKAIVQSSDSFTSSAAAATQQIEDVGVIPA
SALPGRRNSNQKLEKSPSALSSSGKSGKKPNPLSPLYTSVANALNTLIDFIDKEITSKQL
KFVTVLNSETMNPNILPRLIEESKVSSKGFFEYYYFLQKECSDVFNVKPQEFTSIGSIMQ
YLSLREKQDNVSTKSLFKCMSKLLTLILAADHKFTSQPLRNNKLALGYTSSSQNTPPQVN
PQNIHSFKGNNHSYNFLNSGASLSTGFGAAQNMYSNNFSQQAASNHIYQTGGNFFVGSTK
SVPPPNNSTQNNTSNQTQQQSYSHSLILPLGGTSNRKSIDISNYPNPYGNNQQQFNLVQQ
GNTGSSTNIIDLSSDPSLQEEVKGQHKEQIKEITPFSQSSQSHSQQTNQNTLSQQAATQN
ASNLGSLMEGLKSSGQNSNLNSSQVINASLTNTQSNGVGNSSAVQNQQNNSSHNSQAIEK
DKSRSKSKQYNKKEEKSHSKSRYRYSSRRKSNSRDNSSSHQQEMNKKRRSSYSSQRSPSS
SIRRQHNQSSNQASLYNPKSRNENNNPYYKNRKGYIPYNAYNNRKNYNQKSASSSSKSNS
RSRSHSHSRSRSRSSRSKTSSSISSRVEQNRFNYRKGNGSKSPSQQNKRDFYKGGNNNNY
YNKNKHFKKYDNYKRRNSQSNERGGYQYGRYQNYRHDHYQNNRSYNNGPDGEYGSSNYNR
KGDSRERYPPSTLNKRASVSKSHSAGRGSIQRQNNNNMYGGNQQSQNPYNSQSKYNQYYY
YLKFKDLPNCSKQDLYNFIKNNSNVRVYKENIFLLADKYDNFSGEAYIRLEKERDANDLQ
YLSGKEFDLKKISIDKSSHDSFKRKNIFHESVSSNSNSPNRYQGTQNKYQSNTQQHNSYQ
NQDKLKQNNSRDKSQNRTKSSSKRKEAQNASSSSSSSSSSSSSSSSSSSSNKSEASDKQK
PQERQKDQEENTNKNDSTNNKSQQENINDNSNKISKSPSQAKQNTTANNNQQNKYLEVKE
QNNNNNNNNINSSSNNNNNNNNKLSNSSSNQYQNIQNKYQKHNRYDRSRSASRRSRSSSQ
FDRRSSSANKPIDFKSKRVLQQYGILRIRGLPYSCKTKEIYEFFKDFEIVQDGVKRVYNY
QEQKQTGESFIILKNKDQVREAKQKLHGERIFQRYIEVFQSDPNEFLDYLIDKILPQSIS
SKNNRNRYNNFENRKNFNNLNNNNNNNNNNNRYNQDRPFYYDKNERNYSNPHNNNNNNNS
NNGDANKFRNKKYQDKHSRDDESSELDY


>TTHERM_00419990(gene)
ATGAATGTGACATATAACTCTCATAGTAGCACCAACAATACAGGAAATTTTATGTCTTTA
GGGAATTAAAATCCTCAATAAAATAATTTTTACCATAATGGCTTGACTTCAAATACTTAA
TCTCATTATATGGGCTCATAATCAATACTCGGCCAAACATAACCCCCTTTTTATTAAAAT
AATTCAGGATATATACATCCATCAGGATTGTAAGGCATCTCAAATATAAATTCAACATAA
GCAAATATGCTTAATCAAAATTTGAGTCTTACTCTAAATGGCATCATTAACACTCAATCT
GCAATGAATAATTAAATTTCTTAACCTCCTTAGATTATTTAATATCCTATTTACGATCAT
TTTATAATAATTGAATGTGGCTTTGATGATTAGCCTTAATCTGGTTCTCAAATGCGTATT
GAAGATGCTGTTTCACCCTCTGCTTAAAATACATCTAATCTGAATAGTCTTAATGCTTAG
CCCAATTCTTCCTAAAGCAATAACAATAATAATTTAAATAATGTAATTAGTTGTTCACAA
AATATTATTCGTGATATGCATTGGGGAGTATACAGCGTGAAAGAAAGGAGACTTATTAAA
GATTAATATTATGATTTTTCCAATCTAGACAATAAAGCTATCGTATAATCATCTGATTCA
TTTACATCTAGTGCAGCTGCTGCCACCTAACAAATCGAAGATGTTGGAGTTATACCTGCT
TCAGCACTTCCTGGAAGAAGGAATTCAAACTAAAAGTTAGAAAAATCCCCTTCTGCTCTA
AGCTCTAGTGGAAAAAGCGGGAAAAAGCCGAATCCTCTCAGCCCCCTCTACACTTCCGTG
GCTAATGCTCTAAACACATTAATAGATTTTATAGATAAAGAGATTACTTCAAAATAATTA
AAATTTGTTACAGTTTTAAACAGTGAAACTATGAACCCTAATATATTGCCACGTTTGATT
GAAGAAAGCAAAGTCTCTTCAAAAGGATTTTTTGAATATTATTATTTTTTATAAAAAGAA
TGCAGTGATGTTTTTAATGTTAAACCTTAAGAATTTACTTCAATAGGCTCTATCATGCAA
TATTTATCATTAAGAGAGAAACAGGATAATGTTTCCACCAAGAGTTTATTTAAATGCATG
TCTAAGCTACTTACTCTCATTCTAGCTGCTGATCATAAATTTACCAGTTAGCCTTTACGT
AATAATAAATTAGCTTTGGGTTATACATCTTCTTCATAAAATACTCCACCTTAGGTTAAT
CCTCAAAACATTCACTCCTTCAAAGGCAATAATCATTCATATAATTTTCTTAATTCAGGA
GCCTCCCTTTCTACGGGCTTTGGTGCAGCATAAAATATGTATTCAAATAATTTCTCCTAG
CAGGCTGCTTCTAATCACATCTATTAGACAGGAGGTAATTTTTTTGTTGGCTCTACGAAA
AGTGTTCCTCCACCAAATAATTCAACTTAAAATAATACCTCCAATCAAACTCAATAGCAG
TCGTATAGTCATTCCCTTATACTGCCGCTGGGAGGAACTAGTAATCGTAAGAGCATAGAT
ATTAGTAATTACCCTAATCCTTATGGCAACAATCAGCAATAATTTAATCTTGTATAGCAG
GGAAATACTGGTTCAAGCACAAATATAATTGACCTGAGCTCAGATCCCTCTTTGTAAGAA
GAAGTAAAAGGCTAGCATAAGGAATAAATAAAAGAAATAACACCTTTCAGTTAATCTTCC
TAATCTCACTCTTAGTAGACAAATTAAAATACTTTATCTCAGTAAGCTGCAACATAAAAT
GCATCTAATTTAGGTTCTTTGATGGAGGGATTAAAGAGCAGTGGATAAAATTCCAATCTA
AACTCATCATAAGTAATTAATGCCTCTCTCACTAATACATAATCAAATGGTGTAGGAAAT
TCATCGGCTGTATAAAATTAACAGAATAACTCATCACATAATAGTCAAGCAATTGAAAAG
GATAAATCCCGCTCTAAATCAAAACAGTATAATAAAAAAGAAGAAAAAAGCCACAGCAAA
AGCAGATATCGCTACTCTAGTAGGCGAAAGAGTAATTCAAGAGATAACAGCAGCAGTCAT
TAATAAGAAATGAACAAAAAGAGAAGAAGTAGCTACTCTTCTTAACGCTCGCCAAGTTCA
TCAATTCGCAGATAGCACAACTAATCTTCTAATTAAGCTAGTTTGTACAATCCTAAAAGT
AGAAACGAAAACAATAATCCCTATTATAAGAACAGAAAAGGCTACATTCCTTATAATGCC
TACAATAATCGTAAGAATTATAACCAAAAAAGTGCATCAAGTTCTAGCAAAAGCAACAGC
AGAAGTCGTAGTCATAGCCATAGTCGTAGTCGCAGCCGTAGTAGTAGAAGTAAAACTAGC
AGCAGCATAAGCAGTAGAGTAGAATAAAACAGATTTAACTATAGAAAGGGAAATGGCAGT
AAATCTCCATCTCAACAAAATAAAAGAGATTTTTATAAGGGAGGCAACAATAATAATTAT
TACAACAAGAATAAACATTTTAAAAAGTATGACAACTACAAGAGAAGAAATAGCTAAAGC
AACGAAAGAGGAGGATACCAATATGGTAGGTACTAAAATTATCGACATGATCACTATTAA
AACAATAGATCTTACAACAATGGGCCAGATGGTGAGTACGGCAGCAGTAATTATAATAGG
AAAGGTGATAGTAGAGAAAGATATCCACCATCTACACTAAATAAACGAGCTTCTGTATCT
AAAAGTCACTCTGCAGGAAGAGGCAGCATTTAAAGGTAGAACAACAACAATATGTATGGA
GGAAACCAACAATCTTAAAATCCTTACAACTCATAGTCTAAATACAATTAATATTACTAC
TACCTCAAATTCAAAGACCTTCCTAATTGCAGCAAGCAAGACTTATACAATTTCATAAAA
AATAATTCAAATGTTAGAGTGTACAAAGAAAATATTTTCTTGTTAGCTGACAAATATGAT
AATTTTAGTGGAGAGGCCTACATTCGCTTAGAAAAAGAAAGAGATGCAAATGATTTGTAG
TATTTAAGCGGAAAGGAGTTTGATCTCAAAAAAATTTCAATAGATAAGAGTTCACATGAT
AGCTTTAAAAGAAAAAATATATTCCATGAGAGTGTAAGTTCAAATAGCAATTCGCCAAAC
AGATATTAAGGCACTTAGAATAAATACTAGTCCAACACTTAGCAACATAATTCATATTAA
AATTAAGATAAATTGAAATAAAATAATAGCAGAGATAAATCTTAAAATCGTACTAAATCT
TCCTCAAAAAGAAAGGAGGCACAAAATGCATCTTCTTCCTCTTCATCATCATCTTCGTCT
TCCTCCTCCTCATCGTCTTCCTCCTCTTCAAATAAATCAGAAGCTTCTGATAAATAAAAG
CCCTAAGAAAGATAAAAGGATTAGGAAGAAAACACGAACAAAAATGATAGTACCAACAAT
AAAAGCTAATAAGAAAATATCAATGATAATAGCAATAAAATTAGCAAAAGTCCAAGCTAA
GCCAAATAAAACACTACTGCAAACAACAATTAGTAAAATAAATATTTAGAAGTTAAAGAG
TAAAATAACAATAACAATAATAACAATATAAATTCTAGCAGTAACAACAACAACAACAAT
AATAATAAATTAAGTAATAGCAGCAGCAATTAATATTAAAATATTCAAAACAAATATCAA
AAGCACAATCGATATGATAGAAGTAGAAGTGCTAGTAGAAGAAGCAGAAGTAGCAGCTAA
TTTGATCGCAGATCTTCATCAGCAAATAAGCCTATTGATTTTAAAAGCAAAAGAGTTCTA
TAATAATATGGAATACTTCGTATAAGAGGATTACCTTATTCATGTAAGACGAAGGAAATT
TATGAATTCTTTAAAGATTTTGAAATTGTACAAGATGGTGTTAAAAGAGTTTATAATTAT
TAAGAATAAAAGCAAACAGGAGAAAGCTTTATAATATTAAAAAATAAAGATTAAGTAAGA
GAAGCTAAGTAAAAACTTCATGGAGAGAGAATTTTTCAAAGGTATATAGAAGTTTTTCAA
TCAGATCCTAATGAATTCCTAGATTATTTAATAGATAAAATCTTACCTCAAAGTATAAGT
AGCAAAAACAATCGTAATCGCTATAACAATTTTGAAAATAGAAAAAATTTCAACAATCTA
AATAATAATAATAATAACAACAACAACAATAATAGATATAATTAAGATCGCCCATTCTAC
TATGATAAAAATGAAAGAAATTATTCGAATCCTCATAATAACAACAACAATAACAATAGC
AATAATGGAGATGCAAATAAGTTTAGAAATAAAAAATATTAAGACAAGCACAGTAGAGAT
GATGAAAGTAGTGAGCTTGATTATTGA