Identifiers and Description

Gene Model Identifier

TTHERM_00408740

Standard Name

RRM16 (RNA recognition motif-containing protein 16)

Aliases

PreTt21490 | 44.m00157 | 3714.m00005

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( TIGR01659 ) sex-lethal family splicing factor
  • ( TIGR01649 ) hnRNP-L/PTB/hephaestus splicing factor family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00408740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10274.19.997093137033517e-262RNA-binding protein (711 aa)
OxytrichaContig8744.0.g53.0009023271667765e-140RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02846635.000624069301489e-83mrd1 on chromosome: 4 position
2315842 to 2318657
SGDYPR112C9.001321650308988e-69MRD1 Essential conserved prote
in that is part of the 90S pre
ribosome; required for product
ion of 18S rRNA and small ribo
somal subunit; contains five c
onsensus RNA-binding domains
Stentor CoeruleusSteCoe_307971.5400882849875202e-51
WormBaseWBGene000043152.000214949834694e-50locus:rbd-1 status:Partially
_confirmed UniProt:Q9XU67
protein_id:CAB05631.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00408740(coding)
ATGTCTAGCAGACTCATAGTTAAAAATATTCCAACTAATGTTGATGAAAAAAAGCTGAAA
GAAATATTTTCTAAATTTGGAAGCGTTACTGATGCCAAGGTTTGTTTAAAAGGACAGAAG
CATAGACGTTTTTGCTTTATCGGATATAAATCTGAAGCAGACGCTACTAAAGCAAAGGAA
TATTTCAATAATACCTACATATAAATGAATAAAATATAAGTTGATTTTGCTAAAACATCA
GATGACCCTAATATTGTAAACTAAAAAAACCTAAAGTTTAAAAAAAGAGAAGGTCAATAA
CAGGATTAAAAACTCTAAAAGAAAGTTAAGAAAAATGAAGAATAGCCAAGCGAAGTACCT
ACTAATAGCTCAGAGCTAACAGCTGAATAAAAGTTTGAAGAGTTTAAAAAGTTGATGAAG
GCAGGATCTAAAGGAACAATGAGTTGGAATGATGTTTTAACAACAATTAAATCAAAACCC
ACAAAGAAAGAACTTAAAAACCAAGCCAAAAATGATAAAAAGAAAGGTAACAATTAAGAT
GATGATGAAGAAGGAGAAAATGTAAACTTTGCTCAAACAGCTTTAGATGATTTAGATAAG
CAATTTGATAAGATTAAGAGCAAAAAAAGCAAAGGAAATAACGAAAATGACAATACAAAT
TAGGATGAGTAAGAAGAAAATTAAGAAGTATCTTAAGATGCCAAATAAAAAAATAGTAGT
AGCAATAATGACCCTATGATTGATGATTGCAGACTTTATGTTTTAAATTTACCTTATGAC
ATCACTGAAGAAGAAGTCAAAGATGTCTTCCGTAAATATGGTAAATTACTTGAAATAAAA
ATGCCAAAAGGAAAAGGAGGTTAGTTTAGAGGTTTTGCATACATCACTTACTCTATGGCA
GGTGAAGCCATGAGAGCTTTTGCTGAGTTAGATAATAAGATTTAATTCGGTAGAATTCTA
CATATTAGACCAGCTTTTAAAGAAAATAAATCAGAAGAATAAAAGAAAATAGAGGAAGAA
AAAGCTCAGAAAGACATTGAATTTGAAAAATCATCTTTTAAAAAATAAAAGAAGTCTGAA
TTAAAGAAATCATTAAATGATGACACTAATTGGAATACTCTTTTCTTAAATCCTAACACA
ATCTTAGAAACAGTCGCCTCAAGATACAACATTAAAAAGAGTGATATATTGTCACCTGAT
GCTGAAAATGCAGCTGTTAGAATTGCTCATGCTGAAACTTAAATTATAGCTGAAACTAAA
GAGTGGATGCTTAAATAAGGTCTAAACTTAGATTTCCTCAATACAGACAGAAAGAACTGT
GAAAGATCAAACAATACTATCCTTGTTAAGAATATTTCTTCTAAAGTAGAACAAGATAGT
TTTAAAGATTTGTTCAGTAGATATGGCTACGTTTCTAAATTCTTGCTTGCACCTAACAAG
GCTATTGGTGTAGTTCAATTTGAAGATTAAAGTCATGCTTTGAATGCTTTTGAAAAGCTC
TCCTATTTCTCTGTTAAAAATAATCCTTTATATCTTGAATGGGCTCCTCTTGGTATGATT
GACGTTGAATAGGCAGAAGAAGAAAAAGAAAAAGAAATTGAAATAGAAGATGAGTTATCT
AAGATTCTTTATATTAAGAACTTAAGTTTTAATACAACTGAATCTACACTATAAAGCTTA
TTTGAAAAAGCTAAAGTTGGCACAATTAGATCAGTCAAAATAGTAAAAAATAAAGGCTAA
TCTTAAGGTTATGGCTTTGTTGAATTCTCTGATCATGAAGCTGTTATTAAATCTATTAAA
AAACTTTAAAATTCTCTATTAGATGGTCATTCAATATAATTAAGTGTTTCCAAAAAAGAA
AAGAACGATCCCAAGAAAAAGGAGCGTAAACAAAAATAAGTTGACATCCCTATTTCAACT
AAATTAGTCATAAGAAATCTTGCTTTTGAATGTACTAAAAAAGAAGTAAGAGATCTCCTT
AAAGTGTATGGAGAAGTAAAATCTGTTCGTTTACCAAAGAAGATGAATGGTTAACATAGA
GGTTTTGCTTTCGCAGAATTTTCAAGTGCAGAAGAAGCAAAGAATGCATTTACAGCTTTG
GAAAATACTCACTTGTATGGTAGAAAGCTTGCCATAGAATGGGCCAAAACAGAATGA


>TTHERM_00408740(protein)
MSSRLIVKNIPTNVDEKKLKEIFSKFGSVTDAKVCLKGQKHRRFCFIGYKSEADATKAKE
YFNNTYIQMNKIQVDFAKTSDDPNIVNQKNLKFKKREGQQQDQKLQKKVKKNEEQPSEVP
TNSSELTAEQKFEEFKKLMKAGSKGTMSWNDVLTTIKSKPTKKELKNQAKNDKKKGNNQD
DDEEGENVNFAQTALDDLDKQFDKIKSKKSKGNNENDNTNQDEQEENQEVSQDAKQKNSS
SNNDPMIDDCRLYVLNLPYDITEEEVKDVFRKYGKLLEIKMPKGKGGQFRGFAYITYSMA
GEAMRAFAELDNKIQFGRILHIRPAFKENKSEEQKKIEEEKAQKDIEFEKSSFKKQKKSE
LKKSLNDDTNWNTLFLNPNTILETVASRYNIKKSDILSPDAENAAVRIAHAETQIIAETK
EWMLKQGLNLDFLNTDRKNCERSNNTILVKNISSKVEQDSFKDLFSRYGYVSKFLLAPNK
AIGVVQFEDQSHALNAFEKLSYFSVKNNPLYLEWAPLGMIDVEQAEEEKEKEIEIEDELS
KILYIKNLSFNTTESTLQSLFEKAKVGTIRSVKIVKNKGQSQGYGFVEFSDHEAVIKSIK
KLQNSLLDGHSIQLSVSKKEKNDPKKKERKQKQVDIPISTKLVIRNLAFECTKKEVRDLL
KVYGEVKSVRLPKKMNGQHRGFAFAEFSSAEEAKNAFTALENTHLYGRKLAIEWAKTE


>TTHERM_00408740(gene)
ATGTCTAGCAGACTCATAGTTAAAAATATTCCAACTAATGTTGATGAAAAAAAGCTGAAA
GAAATATTTTCTAAATTTGGAAGCGTTACTGATGCCAAGGTTTGTTTAAAAGGACAGAAG
CATAGACGTTTTTGCTTTATCGGTAAATCTAATATTATAATAGCTTTAAGAAGAGTCTCT
TACTTGTTTTATTATTAAATGTAGGATATAAATCTGAAGCAGACGCTACTAAAGCAAAGG
AATATTTCAATAATACCTACATATAAATGAATAAAATATAAGTTGATTTTGCTAAAACAT
CAGATGACCCTAATATTGTAAACTAAAAAAACCTAAAGGTAATTCAAAAAAACCTATATT
TAATAGCTCTATTTTAAAGCACAATATATAAAATAAAAAGCCTATTAAAGCTTATTTTCA
AAATCATTTTAAAACGCTTATAATTTAAATATTATCTCTGATTGGCTATTAATAATTTAC
ATTTAGTAAAATGCATAAAATTTATTGAAGATAGCTAATTTATTAATTGAATTGAATGCT
TTCTATTGAATAAATTTAAATAAAATTATTTTTTAGTTTAAAAAAAGAGAAGGTCAATAA
CAGGATTAAAAACTCTAAAAGAAAGTTAAGAAAAATGAAGAATAGCCAAGCGAAGTACCT
ACTAATAGCTCAGAGCTAACAGCTGAATAAAAGTTTGAAGAGTTTAAAAAGTTGATGAAG
GCAGGATCTAAAGGAACAATGAGTTGGAATGATGTTTTAACAACAATTAAATCAAAACCC
ACAAAGAAAGAACTTAAAAACCAAGCCAAAAATGATAAAAAGAAAGGTAACAATTAAGAT
GATGATGAAGAAGGAGAAAATGTAAACTTTGCTCAAACAGCTTTAGATGATTTAGATAAG
CAATTTGATAAGATTAAGAGCAAAAAAAGCAAAGGAAATAACGAAAATGACAATACAAAT
TAGGATGAGTAAGAAGAAAATTAAGAAGTATCTTAAGATGCCAAATAAAAAAATAGTAGT
AGCAATAATGACCCTATGATTGATGATTGCAGACTTTATGTTTTAAATTTACCTTATGAC
ATCACTGAAGAAGAAGTCAAAGATGTCTTCCGTAAATATGGTAAATTACTTGAAATAAAA
ATGCCAAAAGGAAAAGGAGGTTAGTTTAGAGGTTTTGCATACATCACTTACTCTATGGCA
GGTGAAGCCATGAGAGCTTTTGCTGAGTTAGATAATAAGATTTAATTCGGTAGAATTCTA
CATATTAGACCAGCTTTTAAAGAAAATAAATCAGAAGAATAAAAGAAAATAGAGGAAGAA
AAAGCTCAGAAAGACATTGAATTTGAAAAATCATCTTTTAAAAAATAAAAGAAGGTAATA
AATTATAAATTTAATAAATAATAAGAATACTTAATATTCCTTATTATATTTTTAATAGTC
TGAATTAAAGAAATCATTAAATGATGACACTAATTGGAATACTCTTTTCTTAAATCCTAA
CACAATCTTAGAAACAGTCGCCTCAAGATACAACATTAAAAAGGTAATTAATTATTTATA
TTAAGTAGGATTTTATTTAATTAAACTAAATATATTTTTATATAAAGAGTGATATATTGT
CACCTGATGCTGAAAATGCAGCTGTTAGAATTGCTCATGCTGAAACTTAAATTATAGCTG
AAACTAAAGAGTGGATGCTTAAATAAGGTCTAAACTTAGATTTCCTCAATACAGACAGAA
AGAACTGTGAAAGATCAAACAATACTATCCTTGTTAAGAATATTTCTTCTAAAGTAGAAC
AAGATAGTTTTAAAGATTTGTTCAGTAGATATGGCTACGTTTCTAAATTCTTGCTTGCAC
CTAACAAGGTAAAAAACATGTTTAAAATAATTAATATTAAAACTTTTGATTAAAATAAAA
GGCTATTGGTGTAGTTCAATTTGAAGATTAAAGTCATGCTTTGAATGCTTTTGAAAAGCT
CTCCTATTTCTCTGTTAAAGTAATAATAATAAAGTTAATATTTATTTGTTTAAATATCTA
TTTAAATATAGAATAATCCTTTATATCTTGAATGGGCTCCTCTTGGTATGATTGACGTTG
AATAGGCAGAAGAAGAAAAAGAAAAAGAAATTGAAATAGAAGATGAGTTATCTAAGATTC
TTTATATTAAGAACTTAAGTTTTAATACAACTGAATCTACACTATAAAGCTTATTTGAAA
AAGCTAAAGTTGGCACAATTAGATCAGTCAAAATAGTAAAAAATAAAGGCTAATCTTAAG
GTTATGGCTTTGTTGAATTCTCTGATCATGAAGCTGTTATTAAATCTATTAAAAAACTTT
AAAATTCTCTATTAGATGGTCATTCAATATAATTAAGTGTTTCCAAAAAAGAAAAGAACG
ATCCCAAGAAAAAGGAGCGTAAACAAAAATAAGTTGACATCCCTATTTCAACTAAATTAG
TCATAAGAAATCTTGCTTTTGAATGTACTAAAAAAGAAGTAAGAGATCTCCTTAAAGTGT
ATGGAGAAGTAAAATCTGTTCGTTTACCAAAGAAGATGAATGGTTAACATAGGTAAATAA
TTAATACTTCATTAAATAACAAAATTAATAATATAAATTTAAAATAATTAGAGGTTTTGC
TTTCGCAGAATTTTCAAGTGCAGAAGAAGCAAAGAATGCATTTACAGCTTTGGAAAATAC
TCACTTGTATGGTAGAAAGCTTGCCATAGAATGGGCCAAAACAGAATGA