Identifiers and Description

Gene Model Identifier

TTHERM_00399610

Standard Name

RRM15 (RNA recognition motif-containing protein 15)

Aliases

PreTt12704 | 43.m00222 | 3713.m00051

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08648 ) Protein of unknown function (DUF1777)
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00399610

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig6545.0.g460.0004999512321494991GCC2 and GCC3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00399610(coding)
ATGCTAAGAGAAACATTTGGAGAAAGTACGCATTTGTTTCTTTTAAAGAAGTCAGAGACG
CAGAAGATGCCAAAAAGTAGATGCATAAAAAAGATTTAGGAGGTTTATTGGTAACTGTTG
AATGGTCTAAGTAATCAGGAAGGTTTGAAGAAAATAGCAGTGGAAGATTTAGAGGAAGAA
GAAGAAGCTCCCGTTCAAGAAGTAGAAGAAGAAGCTCATCAAGAGATAGAAGTAGAAGAA
GAAGATACTCTAGATCAAGATCTTCAAGCAACCATTCATCAGATAGAAAAATTTCAAGAA
GAAGAGATAGAAGCAGAAGTGGAAGTAGAAGAAGAACTAGAAGAAGCAGCAGAAGTGATA
GTCGAAAAAACAGTAGAAAGAGAGATGAAAAAAAAACTAATGGGTCTGATAGAAGAAGAA
GAAGATCTGAGTCCTCAAAGAAAAAAAAATCCTCTAGAGATGACAGAAGTCCTAAGAAAG
ATAGCTCTAGCAAAGATAAGAAGTCAGAAAATGGAAAAAGAAAAGACTCTAGTCTATCTC
CTAAAAAATAAATCAGCTCAGAAAATAAATCTGAATTAAAAGATTAAGACATTGAAAACA
AAGAAAGCACTCAAATTGAGGAATAGACTCAATCTCAATAATAGTAACAACAATAAGAAG
AAATTATCAATGAGTGAATTATTTGTAAATTTTTTTGATTAAAATGTGAAACTTACACTT
ATCCAAACCATAAAAGCAAAAATCAACTCTTAAAATTTAAAAATGATTTATTTTACATTC
AAAGTTGTATTTTATCTGTATTTTTTTAAAAGTTTGTCACCATTATATTTTATTATTAAT
TTAAGTAAGAGTGCTTTTTTCTTTCTTTAATTTTATTTATTGTTTTAAAATACATTCTTC
AATAACTACAAGTCATCATTTATTCATGTATTAAACATATTTTTTTATGAAAATTATCAA
AATGATAAAATTAATGATATTATTTTTTTAAATTGTAATTACAATAGAATAATTTTATCG
AAATATCAATATTTTAATGTTTCTTTTTATTCTATTTTTTCAATTTTATAATTTTATGAA
TCAAATAATTAATGA


>TTHERM_00399610(protein)
MLRETFGESTHLFLLKKSETQKMPKSRCIKKIQEVYWQLLNGLSNQEGLKKIAVEDLEEE
EEAPVQEVEEEAHQEIEVEEEDTLDQDLQATIHQIEKFQEEEIEAEVEVEEELEEAAEVI
VEKTVEREMKKKLMGLIEEEEDLSPQRKKNPLEMTEVLRKIALAKIRSQKMEKEKTLVYL
LKNKSAQKINLNQKIKTLKTKKALKLRNRLNLNNSNNNKKKLSMSELFVNFFDQNVKLTL
IQTIKAKINSQNLKMIYFTFKVVFYLYFFKSLSPLYFIINLSKSAFFFLQFYLLFQNTFF
NNYKSSFIHVLNIFFYENYQNDKINDIIFLNCNYNRIILSKYQYFNVSFYSIFSILQFYE
SNNQ


>TTHERM_00399610(gene)
ATGCTAAGAGAAACATTTGGGTAATGAAAAATCAACAACATCATCATCAAAATACCAAGC
AACAAGCATCTATCTACCCATCCATCCTTCCATCCACCCATTCAACCAACATGTTCATAT
TCCCTAGATTAAATACCACCCAAACAGCAAAACAATAAGCTTACCATAATATAGTAAAAT
CAACAAAAAATTTCTTTTAATTTAAAATCATCATTGTTGAGAGAAAGAAAGCATAATATA
TAATATGAATTTTTTCAATAAACAAAATTATTTATATAATATTTAATATTTTCGATATCT
AAAAATAGATGCTAATAAATAAATTAGCCATATTAATTGCTTACTTAATCAAATGAATTA
AAAAATGTATTGTGAAAAAATATTTTTTAAGCAAATTGGATTGATTCATTATTTTTGCTC
TATTTAACCAAAAAATGAAAATTAATAAGCAAAATAAACTAAAACATGATAAAATAAGTA
GTAATTAATTATTTCAGAAATGGCTATTTTTTATTTATTGATATAATTAAGTAACTTGTT
TGATTATAAAAAAAGGAGATATATTAAGCTATTTTATCCATTATTACTTTACAAATAAAA
TAGAAGGAAAATAAATAATTTCTCTTCATTAATTTCACTTTTTATTAATTTATTGTTAAA
TTGTGATTTTGTAATAATATATTCAAATTTAATATTAGAGAAAGTACGCATTTGTTTCTT
TTAAAGAAGTCAGAGACGCAGAAGATGCCAAAAAGTAGATGCATAAAAAAGATTTAGGAG
GTAAGAAATTAAAAATTTACATCCAACAATAGAAAACAAAAAAATATTTTATGATATAAA
AATAATAATAAATAGTTAATTTTGTAATAAATAAACAAATATTTAAGGATTTATAATGAA
TTATTATTTTATGAGTAATAAATTTATTTACTTATTTATTTTAGGTTTATTGGTAACTGT
TGAATGGTCTAAGTAATCAGGAAGGTTTGAAGAAAATAGCAGTGGAAGATTTAGAGGAAG
GTAAATAAATAAATAATACCAATGCAAAAGAAGTAAGTTTTTTATTTTAATTTAAATAAT
TTAAATAGAAGAAGAAGCTCCCGTTCAAGAAGTAGGTAAAATAATAACATTTTTTTTAAT
ATCCACGCTTGAATCATTTTCTAATTAATAGAAGAAGAAGCTCATCAAGAGATAGAAGTA
GAAGAAGAAGATACTCTAGATCAAGATCTTCAAGCAACCATTCATCAGATAGAAAGTAAA
TAACTAAATAAATAATTTTAATTTTCTAAGTATTTTTTATTAATTAAATATTTAATATTT
CTTTGTTTATTTCTTTAGAATTTCAAGAAGAAGAGATAGAAGCAGAAGTGGAAGTAGAAG
AAGAACTAGAAGAAGCAGCAGAAGTGATAGTCGAAAAAACAGTAGAAAGAGAGATGAAAA
AAAAACTAATGGGTCTGATAGAAGAAGAAGAAGATCTGAGTCCTCAAAGAAAAAAAAATC
CTCTAGAGATGACAGAAGTCCTAAGAAAGATAGCTCTAGCAAAGATAAGAAGTCAGAAAA
TGGAAAAAGAAAAGACTCTAGTCTATCTCCTAAAAAATAAATCAGCTCAGAAAATAGTAA
AAATTGTATTTATTTGTTGAAAAAATAATATCTTAAAATATTAACAAATTTAAAAGAATC
TGAATTAAAAGATTAAGACATTGAAAACAAAGAAAGCACTCAAATTGAGGAATAGACTCA
ATCTCAATAATAGTAACAACAATAAGAAGAAATTATCAATGAGTGAATTATTTGTAAATT
TTTTTGATTAAAATGTGAAACTTACACTTATCCAAACCATAAAAGCAAAAATCAACTCTT
AAAATTTAAAAATGATTTATTTTACATTCAAAGTTGTATTTTATCTGTATTTTTTTAAAA
GTTTGTCACCATTATATTTTATTATTAATTTAAGTAAGAGTGCTTTTTTCTTTCTTTAAT
TTTATTTATTGTTTTAAAATACATTCTTCAATAACTACAAGTCATCATTTATTCATGTAT
TAAACATATTTTTTTATGAAAATTATCAAAATGATAAAATTAATGATATTATTTTTTTAA
ATTGTAATTACAATAGAATAATTTTATCGAAATATCAATATTTTAATGTTTCTTTTTATT
CTATTTTTTCAATTTTATAATTTTATGAATCAAATAATTAATGA