Identifiers and Description

Gene Model Identifier

TTHERM_00399550

Standard Name

RRM14 (RNA Recognition Motif-containing protein 14)

Aliases

PreTt12698 | 43.m00216 | 3713.m00045

Description

RRM14 RNA recognition motif protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00399550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14001.12.9986068920536807e-84hypothetical protein (252 aa)
OxytrichaContig16564.0.g255.002171138422328e-22RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000046980.000000100009565553302locus:rsp-1 Probable splicin
g factor, arginine/serine-rich
1 status:Confirmed UniPro
t:Q23121 protein_id:CAA91395
.1
SGDYNL016W0.00000019998969434520019PUB1 Poly (A)+ RNA-binding pro
tein, abundant mRNP-component
protein that binds mRNA and is
required for stability of man
y mRNAs; component of glucose
deprivation induced stress gra
nules, involved in P-body-depe
ndent granule assembly
DictyBaseDDB_G02803930.000006997203421143941DDB_G0280393 on chromosome: 3
position 3254509 to 3256772

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00399550(coding)
ATGAGCTAGTTTAGTTTATTTGTAGGGAATGTTTCAAAGAATGTAGATTAAAAACGTTTA
GAGAAAGAGTTCTCTAAGTTTGGCGAATGCACTGTCGATTTGAGAAGAAAGTACGCATTT
GTCTCTTTTAAAGAAGTCAGAGATGCAGAAGATGCCAAAAAGTAGATGCATAAAAAAGAT
TTAGGAGGTTTATTGATAACTGTTGAATGGTCTAAGTAATCAGGAAGGTTTGAAGAAAAT
AGCAGCGGAAGATTTAGAGGAAGAAGAAGAAGTTCATCAAGAGATAGAAGTAGAAGAAGA
AAAAGATACTCTAGATCAAGATCTTCACGCAGCCATTCATCAGATAGAAAAACTTCAAGA
AGAAGAGATAGAAGCAGAAGTGGAAGTAGAAGAAGAACTAGAAGAAGCAGCAGAAGTGAT
AGTCGAAAAAACAGTAGAAAGAGAGATGAAAAAAAAACTAATGGGTCTGATAGAAGAAGA
AAAAGATCTGAGTCCTCAAAGAAAAAAAAATCCTCTAGAGATGACAGAAGTCCTAAGAAA
GATAGCTCTAGCAAAGATAAGAAGTCAGAAAATGGAAAAAGAAAAGACTCTAGTCTATCT
CCTAAAAAATAAATCAGCTCAGAAAATAAATCTGAATTAAAAGATTAAGACATTGAAAAC
AAAGAAAGCACTCAAATTGAGGAATAGACTCAATCTCAATAATAGTAACAACAATAAGAA
GAAATTATCAATGAGTGA


>TTHERM_00399550(protein)
MSQFSLFVGNVSKNVDQKRLEKEFSKFGECTVDLRRKYAFVSFKEVRDAEDAKKQMHKKD
LGGLLITVEWSKQSGRFEENSSGRFRGRRRSSSRDRSRRRKRYSRSRSSRSHSSDRKTSR
RRDRSRSGSRRRTRRSSRSDSRKNSRKRDEKKTNGSDRRRKRSESSKKKKSSRDDRSPKK
DSSSKDKKSENGKRKDSSLSPKKQISSENKSELKDQDIENKESTQIEEQTQSQQQQQQQE
EIINE


>TTHERM_00399550(gene)
ATGAGCTAGTTTAGTTTATTTGTAGGGAATGTTTCAAAGAATGTAGATTAAAAACGTTTA
GAGAAAGAGTTCTCTAAGTTTGGCGAATGCACTGTCGATTTGAGAGTAAATAGAATCATT
TTATTAACAAATTTAGCAATAAACTGAAGATTTTTATTTAAAAATTTTTAAACTTTCAAT
AAAGTGACCCATAAATCAACTACTGCACAAGCAATCAATAAAATACCATCATCTTATTTT
ATTGATCTTGTAATAATCTAAATAAATCATACATACATACATAATTGCTAACTTCTGAAA
TTTGAAGCTAAGCACTTTTCAATTTTTCTAAGATTATCTTTGCAGCAGTTCGGAACAAAT
ATTCCTGCCTAGCGATGACTGACCTTCGGGTAGCTTTTCAATAATATCCTCCCATTCTTT
ATTGCCATCTCCTATATTTAGAGTCAGGCACTTCAAATAATATATCTCATCGCCAGCAGA
ATTACCCAAAAATATGATTAATAAAAAATCATAAATTGAATTCTGCTTAGATTGCTTTGC
TTTATAATTCTCCTTAAAATGAGAGTATCTATCCAACAACCACCCACACACCCTTCCTAC
CATCTACCAACCCACCAATCGATTCAACCAATCATCAATAATTTTCTATGCTAAGAGAAA
CATTTGGGTCATGAAAAATCAACAACATCATCATCAACATACCAAGCAACAAGCATCTAT
CTACCCATCCATCCATCCACCCACCCATTCAACCAACATGTTCATATTCCCCTAGATTAA
ATACCACCCAAACAGCAAAACAATAAGCTTACCATAATGTAGTAAAATCAACAAAAAATT
TCTTTTAATTTAAAATCATCATTGTTGAGAGAAAGAAAGCATAATATATAATATAAATTT
TTCAATAAGCAAAACTATTTATATAATATTTAATATTTTCGATATCCAAAAATAGATGCT
AATAAATAAATTAGCCATATTAATTGCTTACTTAATCAAATGAATTAAAACATGTATTGT
GAAAAAATATTTTTTAAGCAAATTGGATTGATTCATTTTTGCCCTATTTAACTAAAAAAT
TAAAATTAATAAGCAAAATAAATTAAAATATGATAAAATAAGTAGTAATTAATTATATCA
GAAATGGCTATTTTTTATTTATTGATATCATTAAGTAACTTGTTTGATTATAAAAAAGGA
GATATATAAAGCTAATTTATCTATTATTACTTTACTTACAAATAAAATAAAAGGAAAATA
AATAATTTCTCTTCTTTAATTTTACTTTTTATTAATTTTTACTAAATTGCGATTTAGTAA
TAATAAATTCAAATTTAATATTAGAGAAAGTACGCATTTGTCTCTTTTAAAGAAGTCAGA
GATGCAGAAGATGCCAAAAAGTAGATGCATAAAAAAGATTTAGGAGGTAAGAAATTAAAA
ATTTACATCCATAGAAGAAAAAAAAATTTCATGATATAAAATAATAATAATTTTGTAATA
ATTAAACTAATATTTAAGGATTTAAATTAATTATTATTTTATGAGTAATAAATTTATTTA
CTTATTTTAGGTTTATTGATAACTGTTGAATGGTCTAAGTAATCAGGAAGGTTTGAAGAA
AATAGCAGCGGAAGATTTAGAGGAAGGTAAATAAATGAATAATATCAAAACAAAAAAAGT
TAACTTTACATTTTCATTTAAATATTTTAAATAGAAGAAGAAGCTCTCGTTCAAGAAGTA
GGTAAAATAATAACATTGTTTTAAATATTCACACTTGATGTTGAATATTTTTCTATTTAA
TAGAAGAAGAAGTTCATCAAGAGATAGAAGTAGAAGAAGAAAAAGATACTCTAGATCAAG
ATCTTCACGCAGCCATTCATCAGATAGAAAGTTAATAACTAAATAAATAAATAATTTTAA
TTTTCTAAGCATTTTTGATTAATTAAATATTTAATATTTCTTTCTTTATTTCTTTTTAGA
ACTTCAAGAAGAAGAGATAGAAGCAGAAGTGGAAGTAGAAGAAGAACTAGAAGAAGCAGC
AGAAGTGATAGTCGAAAAAACAGTAGAAAGAGAGATGAAAAAAAAACTAATGGGTCTGAT
AGAAGAAGAAAAAGATCTGAGTCCTCAAAGAAAAAAAAATCCTCTAGAGATGACAGAAGT
CCTAAGAAAGATAGCTCTAGCAAAGATAAGAAGTCAGAAAATGGAAAAAGAAAAGACTCT
AGTCTATCTCCTAAAAAATAAATCAGCTCAGAAAATAGTAAAAATTGTATTTATTTGTTG
AAAAAATAATATCTTAAAATATTAACAAATTTAAAAGAATCTGAATTAAAAGATTAAGAC
ATTGAAAACAAAGAAAGCACTCAAATTGAGGAATAGACTCAATCTCAATAATAGTAACAA
CAATAAGAAGAAATTATCAATGAGTGA