Identifiers and Description

Gene Model Identifier

TTHERM_00384810

Standard Name

RRM13 (RNA recognition motif-containing protein 13)

Aliases

PreTt24773 | 41.m00180

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 72.5%

TetraMine Data

TTHERM_00384810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig6671.0.g587.002638123733849e-21RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
SGDYNL175C3.001003044337619e-17NOP13 Nucleolar protein found
in preribosomal complexes; con
tains an RNA recognition motif
(RRM)
WormBaseWBGene000039029.001232279470736e-16locus:pab-1 status:Confirmed
UniProt:Q9U302 protein_id
:CAA21572.1
Tetrahymena borealisEI9_01741.10.000000000000001999258566166494hypothetical protein (295 aa)
DictyBaseDDB_G02754590.000000000000008002679274403579DDB_G0275459 on chromosome: 2
position 6113524 to 6114624
Stentor CoeruleusSteCoe_351420.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00384810(coding)
ATGATAAGTATTTTAATTTGGCTTTTATTTTAGCTAGATACATATCTAGGCAATATTACT
CCTGATGAGACTGAATAAAACTTTAAATTTTCTAACGAAGTTATTGTTAAAGGTTTGAGC
TTCGATGCTAATGAAAACGATATTAGTAACTACTTTGACCAAAAATGTGGTCAAGTTTCT
AAAGTTAAACTCTTAATGAACTCATAAGGACGTTCGAAGGGTATTGCATTTGTCAGTTTT
GAAACTGAAGAGGGGTATAATAAAGCTCTTGAAATGAATAACTCAGAATTTATGGGTAGA
TATCTTATCATTGAAAAGACTAAGTCTAAGGCTGAAAGGTTAACTCAGATGCATTCTTAT
GCTGATTAAGGTCCTAAAATTGTGATTGTTGATAATATCTCTTCAAAAATTAATAAGTTC
GATAATGAAGTTATTGTTAAGGGTTTGAGCTTTGATGCAGATGAAAATGATATTGGTAAC
TACTTAAACGAAAACTGTGGTTCCGTTACTAGAGTTAACCTCTTAAAGAATGAATAAGGA
TGTTCTAAAGGTGTTGCCTTCGTCAGCTTTGAAACTGAAGAAGGTTGCAACAAGGCTGTT
GAATTGAGCGACTCTGAATTCATGGGTAGATAAATTTTTATTGAAAAGACCAAGCCAAAA
ATTGAAAGACCTGCTCAATTACCTGCTGATCAAGACTCCAAGACTATCTTTGTTGGTAAC
CTCTCTTTCGTAACAAATAAGGAAACTCTTAAGAAGTTCTTCGCCTCTTGTGGCAAGGTT
GTTAATGCTCGTATCGCTGAAGCTGAAGGAAAGAGCAGAGGTTTCGGTCACGTTGAATTC
GAAGAAAGATCTGGTGTTGAAAATGCTTTAAAGATGGCTGGTGAATAAATCGACGGAAGA
CCCATCAGGGTTGATGTCGCTGCTTCCAGAGGTAAACTTGTAGGTTTCAACAGAATCTAA
TGA


>TTHERM_00384810(protein)
MISILIWLLFQLDTYLGNITPDETEQNFKFSNEVIVKGLSFDANENDISNYFDQKCGQVS
KVKLLMNSQGRSKGIAFVSFETEEGYNKALEMNNSEFMGRYLIIEKTKSKAERLTQMHSY
ADQGPKIVIVDNISSKINKFDNEVIVKGLSFDADENDIGNYLNENCGSVTRVNLLKNEQG
CSKGVAFVSFETEEGCNKAVELSDSEFMGRQIFIEKTKPKIERPAQLPADQDSKTIFVGN
LSFVTNKETLKKFFASCGKVVNARIAEAEGKSRGFGHVEFEERSGVENALKMAGEQIDGR
PIRVDVAASRGKLVGFNRIQ


>TTHERM_00384810(gene)
ATGATAAGTATTTTAATTTGGCTTTTATTTTAGCTAGATACATATCTAGGCAATATTACT
CCTGATGAGACTGAATAAAACTTTAAATTTTCTAACGAAGTTATTGTTAAAGGTTTGAGC
TTCGATGCTAATGAAAACGATATTAGTAACTACTTTGACCAAAAATGTGGTCAAGTTTCT
AAAGTTAAACTCTTAATGAACTCATAAGGACGTTCGAAGGGTATTGCATTTGTCAGTTTT
GAAACTGAAGAGGGGTATAATAAAGCTCTTGAAATGAATAACTCAGAATTTATGGGTAGA
TATCTTATCATTGAAAAGACTAAGTCTAAGGCTGAAAGGTTAACTCAGATGCATTCTTAT
GCTGATTAAGGTCCTAAAATTGTGATTGTTGATAATATCTCTTCAAAAATTAATAAGTTC
GATAATGAAGTTATTGTTAAGGGTTTGAGCTTTGATGCAGATGAAAATGATATTGGTAAC
TACTTAAACGAAAACTGTGGTTCCGTTACTAGAGTTAACCTCTTAAAGAATGAATAAGGA
TGTTCTAAAGGTGTTGCCTTCGTCAGCTTTGAAACTGAAGAAGGTTGCAACAAGGCTGTT
GAATTGAGCGACTCTGAATTCATGGGTAGATAAATTTTTATTGAAAAGACCAAGCCAAAA
ATTGAAAGACCTGCTCAATTACCTGCTGATCAAGACTCCAAGACTATCTTTGTTGGTAAC
CTCTCTTTCGTAACAAATAAGGAAACTCTTAAGAAGTTCTTCGCCTCTTGTGGCAAGGTT
GTTAATGCTCGTATCGCTGAAGCTGAAGGAAAGGTATCTAACCAATTTAAATACATATTT
ATTAAAATTTTTTCTGAAAATTTGATGGGGTATAGCTTACTTATAATTTATTTTAGGGAA
ATATTTTATTTAAAATTAGTAAGTAGATAAAAGTTTTTATTATGAACATACTACACTTAT
TAGAATTAGTAGGAGTTTACAATATGATGATATAAATAATTAATTACAAATAAAAATATA
AATTGATTAATAATAGTATTTTTGTTAATAGATAAAAATAACAAAAAATAAAATAAAACT
TCCTAATTTAGTTAGAAATGAATAAGTAAAATTGCTAAGTTTCCCTGAATCACTAAGATA
ATAAATAAATAATTACATGATAACTTTTAATTTTATTCAAATTTTAAATATAATTTTTAA
AAATGTAGAGCAGAGGTTTCGGTCACGTTGAATTCGAAGAAAGATCTGGTGTTGAAAATG
CTTTAAAGATGGCTGGTGAATAAATCGACGGAAGACCCATCAGGGTTGATGTCGCTGCTT
CCAGAGGTAAACTTGTAGGTTTCAACAGAATCTAATGA