Identifiers and Description

Gene Model Identifier

TTHERM_00353440

Standard Name

RRM12 (RNA recognition motif-containing protein)

Aliases

PreTt05358 | 36.m00322 | 3703.m00181

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05672 ) E-MAP-115 family
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19.5%

TetraMine Data

TTHERM_00353440

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09853.11.0002124404074584e-26hypothetical protein (578 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00353440(coding)
ATGAAAATAAATTTTAATTTAATATTTATTTATTCATTTTTATATTCATATTCCAAATTA
TATATAGCCTGTATATTTATTATAAAAACTTCTTTCTTTCTTACTCCAATCTTTTAAATT
ACAGGCACACTTTTAATTAATTTCAAACTATTTAAATAAATTTTAATTACAATAAAAAAT
TCCTTGATTGAAATGGAAAAAAATTAGAATGACCTTTAGGCAATTTATAACTTAGTATCT
AAAAGATACCTGTAGCTCAAGAGAGAAAGTAAAAGCATAAAGTAAGAATATCAGAGTCCT
TTAAATAACTCTGATGAAGATTCAATAAACACCAGGAGTTGCTTAAAGCATAAAATTGAT
TCAAAGAACAAATCATACTTCAGTAGTAAGAAACAATTAGTCTCACAGTAAGAATTCAAA
AACTACTAAGATGAATATAAAAAAGCTTTTATTGGAAGAGAAAAGGCATTTTACATCAAA
TATAAAAATGATTTAAATGCAATTAAATTTTTAAAACACTGCCTATTTAGCCAAATAAAC
TAGTTAGATTTCAGCTAGTGTGTGTAGGGAAATAACTTATGCCTACAAAAAAAGGATTTA
AGAACTAGAATGAAAGAAGTTTATTCATATATAAATCAAAAACAAATTATGGTGTTTCTT
ATTTTAGGACTAGTTATGTTTGGATACAATTTATGGAACTAGTATCAAGAAATCATAATA
GAAAAGAAGACTTTGGATGAGTTTAGGTTAAGGTATGAAAACGAAAGTGAAGCTTTGTAT
TAGATTTTAAAACAAAAACATGCTCTCTATGAAAAAATAAAAAGGCACAAAGATTTTGGG
ATAATTTAATCATTGCTAAATAGATAAATCAAGCTAAAATTTTCTTTTATTTTTGGAGTA
CTTTCTTTACTGCTGAGTCTATTCAAAGCACTATTTTACCACTTTTCTCATAATAAAATA
AGACCTATGCCCTTATTTTAAGGATTAAATATAGAATTGCAAAAGTAGTACTTAAACCAA
GCTAAAATCTCTCAGTAAAATTAAGATAAACCTAAAATAGTTGATCCTCAATAGATTTCA
TAGATATTTTAATAGTAAAAAATGGTAAAAGAGCAAAAGTTCATGGACATTTTCAACTAG
TAAAAAGAATATATTTTAAAAAGATAGCATGAAGAGTTGATAAAAAAAGAAATACTAGAA
TAGAAAAAAAATCAACTACTTCAATAGCTAAATTATTTAAATAAATAAAAGCAGGTCAGT
TAAGAAAAAAAAAGGTAAAATCAAAGAAACACTCTCAGTATGTGTAGCTTTTAAAATAGT
GAAACTGATAATAATGAAAACCATGAATAACTAAGTTTTGTTAGTCAACATTATAATTAT
GATCAATTTCATCAAAGTGAAGATGAAGATTATGATCTTCCATAATTTGGATAAAAAAAA
TCTATTAATCAACTTAATAAATTTCCAAAGAGAAGTAAATTAACTATCTAGCCTAAATAA
TAATTCAATAACTCTATGCACATCAGATCTAAATCTATTGGAAGCGTTTTTTAAATAATC
AATACTAAAAATGAATCTGAGTCATATAAATATTGTGAAAGATTATTTTGA


>TTHERM_00353440(protein)
MKINFNLIFIYSFLYSYSKLYIACIFIIKTSFFLTPIFQITGTLLINFKLFKQILITIKN
SLIEMEKNQNDLQAIYNLVSKRYLQLKRESKSIKQEYQSPLNNSDEDSINTRSCLKHKID
SKNKSYFSSKKQLVSQQEFKNYQDEYKKAFIGREKAFYIKYKNDLNAIKFLKHCLFSQIN
QLDFSQCVQGNNLCLQKKDLRTRMKEVYSYINQKQIMVFLILGLVMFGYNLWNQYQEIII
EKKTLDEFRLRYENESEALYQILKQKHALYEKIKRHKDFGIIQSLLNRQIKLKFSFIFGV
LSLLLSLFKALFYHFSHNKIRPMPLFQGLNIELQKQYLNQAKISQQNQDKPKIVDPQQIS
QIFQQQKMVKEQKFMDIFNQQKEYILKRQHEELIKKEILEQKKNQLLQQLNYLNKQKQVS
QEKKRQNQRNTLSMCSFQNSETDNNENHEQLSFVSQHYNYDQFHQSEDEDYDLPQFGQKK
SINQLNKFPKRSKLTIQPKQQFNNSMHIRSKSIGSVFQIINTKNESESYKYCERLF


>TTHERM_00353440(gene)
ATGAAAATAAATTTTAATTTAATATTTATTTATTCATTTTTATATTCATATTCCAAATTA
TATATAGCCTGTATATTTATTATAAAAACTTCTTTCTTTCTTACTCCAATCTTTTAAATT
ACAGGCACACTTTTAATTAATTTCAAACTATTTAAATAAATTTTAATTACAATAAAAAAT
TCCTTGATTGAAATGGAAAAAAATTAGAATGACCTTTAGGCAATTTATAACTTAGTATCT
AAAAGATACCTGTAGCTCAAGAGAGAAAGTAAAAGCATAAAGTAAGAATATCAGAGTCCT
TTAAATAACTCTGATGAAGATTCAATAAACACCAGGAGTTGCTTAAAGCATAAAATTGAT
TCAAAGAACAAATCATACTTCAGTAGTAAGAAACAATTAGTCTCACAGTAAGAATTCAAA
AACTACTAAGATGAATATAAAAAAGCTTTTATTGGAAGAGAAAAGGCATTTTACATCAAA
TATAAAAATGATTTAAATGCAATTAAATTTTTAAAACACTGCCTATTTAGCCAAATAAAC
TAGTTAGATTTCAGCTAGTGTGTGTAGGGAAATAACTTATGCCTACAAAAAAAGGATTTA
AGAACTAGAATGAAAGAAGTTTATTCATATATAAATCAAAAACAAATTATGGTGTTTCTT
ATTTTAGGACTAGTTATGTTTGGATACAATTTATGGAACTAGTATCAAGAAATCATAATA
GAAAAGAAGACTTTGGATGAGTTTAGGTTAAGGTATGAAAACGAAAGTGAAGCTTTGTAT
TAGATTTTAAAACAAAAACATGCTCTCTATGAAAAAATAAAAAGGCACAAAGATTTTGGG
ATAATTTAATCATTGCTAAATAGATAAATCAAGCTAAAATTTTCTTTTATTTTTGGAGTA
CTTTCTTTACTGCTGAGTCTATTCAAAGCACTATTTTACCACTTTTCTCATAATAAAATA
AGACCTATGCCCTTATTTTAAGGATTAAATATAGAATTGCAAAAGTAGTACTTAAACCAA
GCTAAAATCTCTCAGTAAAATTAAGATAAACCTAAAATAGTTGATCCTCAATAGATTTCA
TAGATATTTTAATAGTAAAAAATGGTAAAAGAGCAAAAGTTCATGGACATTTTCAACTAG
TAAAAAGAATATATTTTAAAAAGATAGCATGAAGAGTTGATAAAAAAAGAAATACTAGAA
TAGAAAAAAAATCAACTACTTCAATAGCTAAATTATTTAAATAAATAAAAGCAGGTCAGT
TAAGAAAAAAAAAGGTAAAATCAAAGAAACACTCTCAGTATGTGTAGCTTTTAAAATAGT
GAAACTGATAATAATGAAAACCATGAATAACTAAGTTTTGTTAGTCAACATTATAATTAT
GATCAATTTCATCAAAGTGAAGATGAAGATTATGATCTTCCATAATTTGGATAAAAAAAA
TCTATTAATCAACTTAATAAATTTCCAAAGAGAAGTAAATTAACTATCTAGCCTAAATAA
TAATTCAATAACTCTATGCACATCAGATCTAAATCTATTGGAAGCGTTTTTTAAATAATC
AATACTAAAAATGAATCTGAGTCATATAAATATTGTGAAAGATTATTTTGA