Identifiers and Description

Gene Model Identifier

TTHERM_00348880

Standard Name

RRM11 (RNA Recognition Motif-containing protein 11)

Aliases

PreTt05300 | 36.m00264 | 3703.m00126

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01661 ) ELAV/HuD family splicing factor
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( TIGR01659 ) sex-lethal family splicing factor
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large
  • ( TIGR01628 ) polyadenylate binding protein, human types

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00348880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09792.19.997093137033517e-262hypothetical protein (479 aa)
WormBaseWBGene000039021.000116773704384e-19locus:pab-1 status:Confirmed
UniProt:Q9U302 protein_id
:CAA21572.1
OxytrichaContig18677.0.g102.000769134519826e-18RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02914865.998633383648922e-18DDB_G0291486 on chromosome: 6
position 413873 to 415521
SGDYER165W0.000000000000008002679274403579PAB1 Poly(A) binding protein,
part of the 3-end RNA-processi
ng complex, mediates interacti
ons between the 5 cap structur
e and the 3 mRNA poly(A) tail,
involved in control of poly(A
) tail length, interacts with
translation factor eIF-4G
Stentor CoeruleusSteCoe_146900.00000000003775134544279098

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00348880(coding)
ATGAATATAAATTGTCAGTAGTAAGAAGAAAGTTCTTTCGAAATAGATTATAGATTTTAG
AATGATTTGATTTCATTTGAAAATCTCATATCGAATTTCAACTAAAGTAAGCAAACTAAA
GACAACATTGAAGTAGATTTTGATAGCTTGCAAGAGCAGACTAATTAGCTTATGCTACTT
CTACAAAAATCAGCTAATAACAATAAATCAATTCAAAATAAATAAAATGATGAGTTAACT
AATTTTGTAATAGATATTTAGATGGTTTTTAATTCAATTCCTATTAAATTATTTATTGGG
CAAGTTCCTAAGGATTGGTAGGAAAGTGATCTTAAGATTTTTTTTGAAAAACATACCAGT
ATCACATAAATTGAAGTAATAAGAGACTAAAAATTTAGACATTAGGGATGCGCTTTTGCT
ACTTTTTCCTCAATGTCTGAAGCAGAAAAAGTTATTGAATTCTACAAAAATAAACATTTT
CCAAACAGTAAGTAGGAAATTATTATGAAGTGGGCTTCTGGAGAAGAAGAAAGACTCGGA
GTCAGCGAGAATTCAAGTCATAAGCTAATTATAAAAAATCTTCCTGCTTTAATATCAGAT
GCAAGTATTTCTAATATATTTGATAATTTTGGTAGAATCTAATAATTAAAAGTCATACGA
GATAAAAAAACAAGTGAATGCAAAGGTCATGCGTTTATTAAATATTATGAGAAAGAGAGT
GCCCATTTAGCTGTCTAGAACTTGAACAAATAAAATATTTACCTAATTTAAAATAAAAAA
TTGAAAGTTTCTTTTATAGAAAAGAGTTATTAAAAAAAGCAAAAGTAAATTCTAAAATAT
ATGAAACAAAATACAAATCAAATAACATAAAATGGCCCTCTGCCTTCTACAATACCTTTT
GAGAAGTATTATTATGAATATTTTAATTAAGGGGAATCTAATCCTATATTTTACCATCCA
TTTACAGATACTTCTTCTACTGAAACTCCTCCTTACTCCTCATTAATCTGGCACGAAGAT
GGTTCTTGCACAATTACACCTAAACTTTTTCCCTGCCATATAGATTTTACAATGTAAAAT
AAAAGAAAAGATGGTATTAAAAAATATACAAATCAAAAATATGTTGTTTAAGGTCCTTCA
CACTCTAATATTTTTGTCTTTCATCTACCTAAATAATATAATGAAAAAAACTTATTTGAG
CTATTTTCAGGTTATGGAAATATCATTTCAATAACTATTTGTAGAAAATAAAATGGTGAA
AGCCGAGGTTATGGATTTGTTAGTTTTAACTAGCCTTATGAGGCAGCTCATGCAATAAAA
GAATTAAATGGTTTAAATTTGATGGGAAAAAGAATAAAAGTAGAACTAAAATAAACCCAT
ATTGAAAAAGTAAATAGCAATCAAAAAACACTAAACTATGAATGA


>TTHERM_00348880(protein)
MNINCQQQEESSFEIDYRFQNDLISFENLISNFNQSKQTKDNIEVDFDSLQEQTNQLMLL
LQKSANNNKSIQNKQNDELTNFVIDIQMVFNSIPIKLFIGQVPKDWQESDLKIFFEKHTS
ITQIEVIRDQKFRHQGCAFATFSSMSEAEKVIEFYKNKHFPNSKQEIIMKWASGEEERLG
VSENSSHKLIIKNLPALISDASISNIFDNFGRIQQLKVIRDKKTSECKGHAFIKYYEKES
AHLAVQNLNKQNIYLIQNKKLKVSFIEKSYQKKQKQILKYMKQNTNQITQNGPLPSTIPF
EKYYYEYFNQGESNPIFYHPFTDTSSTETPPYSSLIWHEDGSCTITPKLFPCHIDFTMQN
KRKDGIKKYTNQKYVVQGPSHSNIFVFHLPKQYNEKNLFELFSGYGNIISITICRKQNGE
SRGYGFVSFNQPYEAAHAIKELNGLNLMGKRIKVELKQTHIEKVNSNQKTLNYE


>TTHERM_00348880(gene)
ATGAATATAAATTGTCAGTAGTAAGAAGAAAGTTCTTTCGAAATAGATTATAGATTTTAG
AATGATTTGATTTCATTTGAAAATCTCATATCGAATTTCAACTAAAGTAAGCAAACTAAA
GACAACATTGAAGTAGATTTTGATAGCTTGCAAGAGCAGACTAATTAGCTTATGCTACTT
CTACAAAAATCAGCTAATAACAATAAATCAATTCAAAATAAATAAAATGATGAGTTAACT
AATTTTGTAATAGATATTTAGATGGTTTTTAATTCAATTCCTATTAAATTATTTATTGGG
CAAGTTCCTAAGGATTGGTAGGAAAGTGATCTTAAGATTTTTTTTGAAAAACATACCAGT
ATCACATAAATTGAAGTAATAAGAGACTAAAAATTTAGACATTAGGGATGCGCTTTTGCT
ACTTTTTCCTCAATGTCTGAAGCAGAAAAAGTTATTGAATTCTACAAAAATAAACATTTT
CCAAACAGTAAGTAGGAAATTATTATGAAGTGGGCTTCTGGAGAAGAAGAAAGACTCGGA
GTCAGCGAGAATTCAAGTCATAAGCTAATTATAAAAAATCTTCCTGCTTTAATATCAGAT
GCAAGTATTTCTAATATATTTGATAATTTTGGTAGAATCTAATAATTAAAAGTCATACGA
GATAAAAAAACAAGTGAATGCAAAGGTCATGCGTTTATTAAATATTATGAGAAAGAGAGT
GCCCATTTAGCTGTCTAGAACTTGAACAAATAAAATATTTACCTAATTTAAAATAAAAAA
TTGAAAGTTTCTTTTATAGAAAAGAGTTATTAAAAAAAGCAAAAGTAAATTCTAAAATAT
ATGAAACAAAATACAAATCAAATAACATAAAATGGCCCTCTGCCTTCTACAATACCTTTT
GAGAAGTATTATTATGAATATTTTAATTAAGGGGAATCTAATCCTATATTTTACCATCCA
TTTACAGATACTTCTTCTACTGAAACTCCTCCTTACTCCTCATTAATCTGGCACGAAGAT
GGTTCTTGCACAATTACACCTAAACTTTTTCCCTGCCATATAGATTTTACAATGTAAAAT
AAAAGAAAAGATGGTATTAAAAAATATACAAATCAAAAATATGTTGTTTAAGGTCCTTCA
CACTCTAATATTTTTGTCTTTCATCTACCTAAATAATATAATGAAAAAAACTTATTTGAG
CTATTTTCAGGTTATGGAAATATCATTTCAATAACTATTTGTAGAAAATAAAATGGTGAA
AGCCGAGGTTATGGATTTGTTAGTTTTAACTAGCCTTATGAGGCAGCTCATGCAATAAAA
GAATTAAATGGTTTAAATTTGATGGGAAAAAGAATAAAAGTAGAACTAAAATAAACCCAT
ATTGAAAAAGTAAATAGCAATCAAAAAACACTAAACTATGAATGA