Identifiers and Description

Gene Model Identifier

TTHERM_00318730

Standard Name

RRM10 (RNA recognition motif-containing protein 10)

Aliases

PreTt21074 | 31.m00376 | 3687.m00177

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02178 ) AT hook motif
  • ( PF06495 ) Fruit fly transformer protein
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00318730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_40998.11.999658401959794e-176hypothetical protein (367 aa)
OxytrichaContig5669.0.0.g969.996273942859018e-26RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000066977.000924640675686e-24locus:uaf-1 Splicing factor
U2AF 65 kDa subunit status:C
onfirmed UniProt:P90978 pr
otein_id:CCD62280.1
Stentor CoeruleusSteCoe_319654.248354255291589e-18
DictyBaseDDB_G02863950.000000004999139696582238u2af2 on chromosome: 4 positio
n 4405482 to 4407497

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00318730(coding)
ATGTATTTTAATTTGTTTAAACTTTATTTGCTTACTTTAAGTAATTTTTTATTTTTATAA
AATGAATTATTAGTTTTTTTGTTAAAAAAGGCTTATAGACATATAGTTTTATAAGATATT
TACTATTTATTATTCAATTCTAATAAAGATATATCTATCAGTCAATCAATCAAATATAAT
CAATTAATCTTAAAAACCTTTCTTCAATCTAAATTTGTTGAATTAGATAGCTAGCTATAT
ATAAATAGGATTGATTAAAAATAAATGAGTTCAAGCAGAGAGAGAAAAAGATCAGATTCT
AGATCTAAAAAGGACAAAAAAGACAAGAAAGATAAAAAGGAGAAAAAGGACAAGAAAGAT
AAGAAAGAGCATAAAGAACATAAAGAAAGAAGAGACTCAAGGGAAAAAAAGTCTAAAAAA
GAATCAAAAGACCGTAGAGATAGAAAAGAAAGTAGGGATAGAGAAGAAAAGAAGGATAAA
AAAGATAAAAAGGATAAAAAGAAAAGAGATAAATCTGAAGATAGAAAAAGGAGAAGTAAC
TCTTATCATTAAAAAAGAAAAAGGTCTTCTACTAAGAGTAGCTCTAGAGGCAGAAAAAGA
TCTCAGCCTTAAAGAGGGTAAAATTTTGGATTTGCGTTTGATAGTCCTCCAAAAGAAATC
ACATAGAAAGAAGAACCTGCATAAAGTTAAGAAGTCGTTAATGACTTTTCAAATGTCATA
AACAATCCTAATTTTAATCCTAAGTTCAAAGAATTATTTATGAAGTTATAGAATAGCAAA
CTGCCTGATTTATAAAATTCAAAGTGCGATAGAAAACTTTATATAGGAAATATTCCTCCT
GGTTTATAGCCAGTTAAATGTTAATTGATGATCAACAGTGCTCTAAAGCAACTCAAAGTC
AATTAAGAAACGCCTGGTGATTCTTGCGTCAGTATATGGATAAGTCCAGAAGGGAATTAT
GGTTTTGCAGAGTTTAGAACACCTGACGAAGCAACAAAAGCTCTTAATGCATTAGTTAAT
GTAACATTATTGGGATAACCATTAAAGGTAGGGAGACCTGCACAATATACAAAATCTTCA
ACTGAAGTTTCATCAAGTGGAGCCAATTCTGGTGCAACTGGTTTTTCTTCAAGTGGTCGT
TTTGATATTCTTAGTTTGTTAGATCCTAATGGCTAAAAAAAGGACTAAGAAGAAGCTGAA
GGTGCATAATAAGCTGCAAATTTAACTTTGATCCCAGGATTAGAGGCTGCTCCACCTGTA
ACAAATAAAAATATGATAAGTTTAAAAGTGTAAATACCAACTAGAATCCTTGTTTTACAC
AATATGATTGCAGATGGTGAATTAATTATTGATGAAGAATTCAGATAAATAGAAGAAGAT
GTAAAAGAAGAATGTTCAAAGCATGGTAAAGTAGTAAAAATAACTATTCCAAGACCTAGC
GATTCAAATGAATAAGTAAAAGGCTAAGGCCGTATTTTTGTAGAATATGAAAATACTGAT
GCAGCAAGAGATGCAAGAAGAGATCTAAATGGTAGATTATTTAACAATAGAACTGTTCAA
GTATAATACTTCAGCGAGCAAAAATATTTAGATGGGGAACTGGATTTTAGAATAAGATGA


>TTHERM_00318730(protein)
MYFNLFKLYLLTLSNFLFLQNELLVFLLKKAYRHIVLQDIYYLLFNSNKDISISQSIKYN
QLILKTFLQSKFVELDSQLYINRIDQKQMSSSRERKRSDSRSKKDKKDKKDKKEKKDKKD
KKEHKEHKERRDSREKKSKKESKDRRDRKESRDREEKKDKKDKKDKKKRDKSEDRKRRSN
SYHQKRKRSSTKSSSRGRKRSQPQRGQNFGFAFDSPPKEITQKEEPAQSQEVVNDFSNVI
NNPNFNPKFKELFMKLQNSKLPDLQNSKCDRKLYIGNIPPGLQPVKCQLMINSALKQLKV
NQETPGDSCVSIWISPEGNYGFAEFRTPDEATKALNALVNVTLLGQPLKVGRPAQYTKSS
TEVSSSGANSGATGFSSSGRFDILSLLDPNGQKKDQEEAEGAQQAANLTLIPGLEAAPPV
TNKNMISLKVQIPTRILVLHNMIADGELIIDEEFRQIEEDVKEECSKHGKVVKITIPRPS
DSNEQVKGQGRIFVEYENTDAARDARRDLNGRLFNNRTVQVQYFSEQKYLDGELDFRIR


>TTHERM_00318730(gene)
ATGTATTTTAATTTGTTTAAACTTTATTTGCTTACTTTAAGTAATTTTTTATTTTTATAA
AATGAATTATTAGTTTTTTTGTTAAAAAAGGCTTATAGACATATAGTTTTATAAGATATT
TACTATTTATTATTCAATTCTAATAAAGATATATCTATCAGTCAATCAATCAAATATAAT
CAATTAATCTTAAAAACCTTTCTTCAATCTAAATTTGTTGAATTAGATAGCTAGCTATAT
ATAAATAGGATTGATTAAAAATAAATGAGTTCAAGCAGAGAGAGAAAAAGATCAGAGTAA
ACTTATTTGCATGATCAAAAATAATTAAGCATGGAATTAAAAACCATTTTATAAAGTTCT
AGATCTAAAAAGGACAAAAAAGACAAGAAAGATAAAAAGGAGAAAAAGGACAAGAAAGAT
AAGAAAGAGCATAAAGAACATAAAGAAAGAAGAGACTCAAGGGAAAAAAAGTCTAAAAAA
GAATCAAAAGACCGTAGAGATAGAAAAGAAAGTAGGGATAGAGAAGAAAAGAAGGATAAA
AAAGATAAAAAGGATAAAAAGAAAAGGTAAATTTTAAATTATTATGAAATAGTGCTCATG
ATTTTATATCAATAATAGAGATAAATCTGAAGATAGAAAAAGGAGAAGTAACTCTTATCA
TTAAAAAAGGTAATCACTTAGCAATAAATAAGCTTTGAGCAATTAGCAGTAAAATTTTAT
TTAAAGAAAAAGGTCTTCTACTAAGAGTAGCTCTAGAGGCAGAAAAAGATCTCAGCCTTA
AAGAGGGTACTTATTAAAAAATAGTAAATTAGGTTTTATCATAAAATATTTTCAATATAT
TCAATAGGTAAAATTTTGGATTTGCGTTTGATAGTCCTCCAAAAGAAATCACATAGAAAG
AAGAACCTGCATAAAGTTAAGAAGTCGTTAATGACTTTTCAAATGTCATAAACAATCCTA
ATTTTAATCCTAAGTTCAAAGAATTATTTATGAAGTTATAGAATAGCAAACTGCCTGATT
TATAAAATTCAAAGTGCGATAGAAAACTTTATATAGGAAATATTCCTCCTGGTTTATAGC
CAGTTAAAGTAATTTCTAAAAACAAAAATATTTTCAAATATTAAAATATTTAAAAAATTA
GTGTTAATTGATGATCAACAGTGCTCTAAAGCAACTCAAAGTCAATTAAGAAGTAATTAA
TTAATTAATTTATATAAATTAATAGATTAAATTATATATTTTTATTTTAAAATACTTAGA
CGGTAAATTTAAGTTCTTCACACAGAATTCATAAGTTCTTTAAAATTAAGTTTATTAAAT
TTAATTTTTATATATTAGCCTGGTGATTCTTGCGTCAGTATATGGATAAGTCCAGAAGGT
ACCTTCTTTTCTTTTCTTTAATTATTAATATTAAAGATTTTCTTTAATTGAAGTTAATTT
ATTTAATTTAAGGGAATTATGGTTTTGCAGAGTTTAGAACACCTGACGAAGCAACAAAAG
CTCTTAATGCATTAGTTAATGTAACATTATTGGGATAACCATTAAAGGTAGGGAGACCTG
CACAATATACAAAATCTTCAACTGAAGTTTCATCAAGTGGAGGTGATTAAATTTTACATT
TTCTATCTAGAATATTAATTCAATTTTTTATATTTTAGCCAATTCTGGTGCAACTGGTTT
TTCTTCAAGTGGTCGTTTTGATATTCTTAGTTTGTTAGATCCTAATGGTAAAAACAATAA
AAAATTTATTTTTATTTATGCTTAAGTATTTATTTATTTTTCTTTAGGCTAAAAAAAGGA
CTAAGAAGAAGCTGAAGGTGCATAATAAGCTGCAAATTTAACTTTGATCCCAGGATTAGA
GGCTGCTCCACCTGTAACAAATAAAAATGTAAAATATTAATTAGATTGGAAATTATGATG
GTATTAATTAAAAAAAAAATTAGATGATAAGTTTAAAAGTGTAAATACCAACTAGAATCC
TTGTTTTACACAATATGATTGCAGATGGTGAATTAATTATTGATGAAGAATTCAGATAAA
TAGAAGAAGATGTAAAAGAAGAATGTTCAAAGCATGGTAAAGTAGTAAAAATAACTATTC
CAAGACCTAGCGATTCAAATGAATAAGTAAAAGGCTAAGGCCGTATTTTTGTAGAATATG
AAAATACTGATGCAGCAAGAGATGCAAGAAGAGTAAAAAAAACAATTTATATATTTAATC
TATTTTTCAACTAATATTTTTTTAAAAAAGGATCTAAATGGTAGATTATTTAACAATAGA
ACTGTTCAAGTATAATACTTCAGCGAGCAAAAATATTTAGATGGGGAACTGGATTTTAGA
ATAAGATGA