Identifiers and Description

Gene Model Identifier

TTHERM_00101140

Standard Name

RRM1 (RNA Recognition Motif-containing protein 1)

Aliases

PreTt22913 | 7.m00362

Description

RNA recognition motif-containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19%

TetraMine Data

TTHERM_00101140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00288.14.00060640795776e-64splicing factor, CC1-like fami
ly protein (548 aa)
OxytrichaContig10134.0.g980.00000000002000577768187062RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
DictyBaseDDB_G02895470.00000005001214305021125DDB_G0289547 on chromosome: 5
position 2930859 to 2932103
WormBaseWBGene000220250.000000100009565553302status:Confirmed UniProt:Q9B
L57 protein_id:CCD71919.1
SGDYPR112C0.0004000184047659232MRD1 Essential conserved prote
in that is part of the 90S pre
ribosome; required for product
ion of 18S rRNA and small ribo
somal subunit; contains five c
onsensus RNA-binding domains

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00101140(coding)
ATGGTTGGAAATAGACCTCCTACAAGTTTGTTGCCCACCAACTATATAGTATTAGTAAAT
ATGTTTACAGAAACTGATTTCTAAAACGATCCCGATTTCTTCACAGATCTTAAAGAAGAT
GTTAGTGAGGAATGCAAAAAGTATGGCGATGTTGTTGAAGTATTTGTAGCAATTCGTAGT
CCTTGTGGTTCTGTATTTGTATTGTTTAATGATGCTACTGGCGCAGTAAATTGTGCAAAG
AATATTGATGGAAGAATGTTTAATGGAAGACCTATTTCTTCATATTGTATTTCAGAAGAC
ACTCTTCAAGATGAATTACAAGAACATCTTTGA


>TTHERM_00101140(protein)
MVGNRPPTSLLPTNYIVLVNMFTETDFQNDPDFFTDLKEDVSEECKKYGDVVEVFVAIRS
PCGSVFVLFNDATGAVNCAKNIDGRMFNGRPISSYCISEDTLQDELQEHL


>TTHERM_00101140(gene)
ATGGTTGGAAATAGACCTCCTACAAGTTTGTTGCCCACCAACTATATAGTATTAGTAAAT
ATGTTTACAGAAACTGATTTCTAAAACGATCCCGATTTCTTCACAGATCTTAAAGAAGAT
GTTAGTGGTAATTAAATGTTTAAATTGATTAAAAAACTCATTCATATTAAATGAGTTAAG
TTAATACTAAATATTTTATTAAAATTATTTATTAGAGGAATGCAAAAAGTATGGCGATGT
TGTTGAAGTATTTGTAGCAATTCGTAGTCCTTGTGGTTCTGTATTTGTATTGTTTAATGA
TGCTACTGGCGCAGTAAATTGTGCAAAGAATATTGATGGAAGAATGTTTAATGGAAGACC
TATTTCTTCATATTGTATTTCAGAAGACACTCTTCAAGATGAATTACAAGAACATCTTTG
A