Identifiers and Description

Gene Model Identifier

TTHERM_00551090

Standard Name

RPT6 (26S proteasome regulatory subunit T6)

Aliases

PreTt29213 | 72.m00136

Description

26S proteasome subunit P45 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( TIGR02880 ) CbbX protein
  • ( PF01202 ) shikimate kinase
  • ( PF00004 ) ATPase, AAA family
  • ( PF01926 ) GTPase of unknown function
  • ( PF00158 ) Sigma-54 interaction domain
  • ( TIGR02881 ) stage V sporulation protein K
  • ( TIGR01242 ) 26S proteasome subunit P45 family
  • ( PF00005 ) ABC transporter, ATP-binding protein
  • ( TIGR00678 ) DNA polymerase III, delta' subunit
  • ( TIGR00635 ) Holliday junction DNA helicase RuvB
  • ( TIGR01241 ) ATP-dependent metallopeptidase HflB
  • ( TIGR02237 ) DNA repair and recombination protein
  • ( TIGR02928 ) orc1/cdc6 family replication initiation protein
  • ( PF07724 ) ATPase family associated with various
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00551090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_215480
WormBaseWBGene000045069.997093137033517e-262locus:rpt-6 status:Confirmed
UniProt:Q9XTT9 protein_id
:CAB11558.1
Tetrahymena borealisEI9_07336.19.997093137033517e-26226S proteasome subunit P45 fam
ily protein (396 aa)
DictyBaseDDB_G02923829.997093137033517e-262psmC5 on chromosome: 6 positio
n 1673522 to 1674865
OxytrichaContig1022.1.g1019.997093137033517e-262ATPase family associated with
various cellular activities (A
AA)
SGDYGL048C9.997093137033517e-262RPT6 One of six ATPases of the
19S regulatory particle of th
e 26S proteasome involved in t
he degradation of ubiquitinate
d substrates; bound by ubiquit
in-protein ligases Ubr1p and U
fd4p; localized mainly to the
nucleus throughout the cell cy
cle

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00551090(coding)
ATGTCAGTAAGTTAAGGTGCAGGATTGAAGGCATTTTATCTTTCTAAGATTGAAGAGCTC
TCTTTGAAAGTTAATGAAAAGTCATAGAATATAAAACGTTTGGAGGCTTAAAGAAACGAA
TATAATAATCAAGTTCGTATGCTCAAAGAAGAATTTTACTCTTTATAATCACCTCACTCT
TATGTTGGTGAAGTTGTTAAGCCAATGGGAAAGAGCAAAGTTTTAGTTAAGATATCTCCT
GATGGCAAATATGTAGTTAATATAGATAAAAGCATTAAAATTGAAGATTGTTTACCAAAT
ACTCGTGTTGCTTTAAAAGGTGACTCTTATGTTCTTCACAAGCTTCTTCCCACTAAGGTT
GATCCTTTGGTTTCTCTCATGAAAGTCGAAAAGGTACCCGATTCTACTTATGATATGATC
GGTGGTCTTGATCAATAAGTTAAGGAAGTAAAGGAAGTTATTGAATTGCCAATTAAGCAT
CCTGAAATTTTTGAGTCTCTTGGTATTGCTTAACCTAAGGGTGTTCTCCTTTACGGACCT
CCTGGTACTGGTAAAACCCTTCTCGCCAGAGCTATTGCACATCATACAGATTGTACTTTT
ATTAGAGTTTCTGGTAGTGAATTGGTTTAGAAATATATTGGTGAAGGAGCAAGAATGGTC
AGAGAATTATTCGTCATGGCTAGATAACATGCTCCTTGTTTGATTTTTATTGATGAAGTC
GATTCTATCGGTGGTGCAAGAATTGATAGTGATAGAGGTGGTGACTCAGAAGTACAAAGA
ACTATGCTTGAACTTCTTAACTAACTTGACGGTTTTGAATCTACAAATAACATTAAAATT
ATCATGGCTACTAATCGTATTGATATATTAGATCCTGCTCTTCTTAGACCAGGTCGTATC
GATAGAAAGGTAGAGTTCCCTAATCCTAGTGTTGAGGCTAGATTAGAAATCTTATCAATC
CACTCAAAGAAAATGAATCTCATGAGAGGTATTAATTTAAAGGCTATAGCTGAAAAGATG
GGAGGAGCTTCTGGTGCAGAATCAAAGGCTGTATGTACTGAAGCTGGTATGTTTGCATTA
AGAGAAAGAAGAATTCATGTTACTCAAGAAGATTTCGAAATGGCTGTTTCAAAGGTTATG
AAAAAGGACTTAGAAAAAAATATGGCTCTTCGTAAATTATGGACATGA


>TTHERM_00551090(protein)
MSVSQGAGLKAFYLSKIEELSLKVNEKSQNIKRLEAQRNEYNNQVRMLKEEFYSLQSPHS
YVGEVVKPMGKSKVLVKISPDGKYVVNIDKSIKIEDCLPNTRVALKGDSYVLHKLLPTKV
DPLVSLMKVEKVPDSTYDMIGGLDQQVKEVKEVIELPIKHPEIFESLGIAQPKGVLLYGP
PGTGKTLLARAIAHHTDCTFIRVSGSELVQKYIGEGARMVRELFVMARQHAPCLIFIDEV
DSIGGARIDSDRGGDSEVQRTMLELLNQLDGFESTNNIKIIMATNRIDILDPALLRPGRI
DRKVEFPNPSVEARLEILSIHSKKMNLMRGINLKAIAEKMGGASGAESKAVCTEAGMFAL
RERRIHVTQEDFEMAVSKVMKKDLEKNMALRKLWT


>TTHERM_00551090(gene)
ATGTCAGTAAGTTAAGGTGCAGGATTGAAGGCATTTTATCTTTCTAAGATTGAAGAGCTC
TCTTTGAAAGTTAATGAAAAGTCATAGAATATAAAACGTTTGGAGGCTTAAAGAAACGAA
TATAATAATCAAGGTATATCATTAAGCGTTGATTTATTTAGTAGATTATAGATAAGAGCA
AAAATTTTCATAAAATAATCAAAAAGCTGGCTAATTACAGCAGTAAAAAAAGGCACAAGC
ACAAAATGCATAAAGCTTTTCTTAATTTGATTAATAAAATAATCTTGCCAATTTTTCATC
AAATAATTACAAATCTATTTTTAAAATGTTTAAAAGACAACAATATTTAATAAATAATTA
ACTTGAGATGAAAACAAAAATGCTTGATTTGTTTTGTAGTGATTGAATTTACCTTTACTA
CACTCAATAAATTGTTTGATTAATTTAAAATATCACAGCTTTTAAAATTATTTCTAAAAA
TTTTGTTTAACTTATAATAAATAAATAGTTCGTATGCTCAAAGAAGAATTTTACTCTTTA
TAATCACCTCACTCTTATGTTGGTGAAGTTGTTAAGCCAATGGGAAAGAGCAAAGTTTTA
GTTAAGGTAGAATATACAATTAAATACAATATTTTATTTTAGACAAAATAAAATATATAT
TAAATTTTTACTTTTGGTTTATGCAATATAAAAATAATAAATTCTTAAATGATTAGATAT
CTCCTGATGGCAAATATGTAGTTAATATAGATAAAAGCATTAAAATTGAAGATTGTTTAC
CAAATACTCGTGTTGCTTTAAAAGGTGACTCTTATGTTCTTCACAAGCTTCTTCCCACTA
AGGTTGATCCTTTGGTTTCTCTCATGAAAGTCGAAAAGGTACCCGATTCTACTTATGATA
TGATCGGTGGTCTTGATCAATAAGTTAAGGAAGTAAAGGAAGTTATTGAATTGCCAATTA
AGCATCCTGAAATTTTTGAGTCTCTTGGTATTGCTTAACCTAAGGGTGTTCTCCTTTACG
GACCTCCTGGTACTGGTAAAACCCTTCTCGCCAGAGCTATTGCACATCATACAGTAAATA
ATTATATTAGAAAATAAACAGTTGGAACCCTCCTATATTTATCACCAATATTTTATTTAA
AAATTTAAATAAATTAGAAGAAAAACGAACTAAAAAATAAATATTAATGTAAAAAAGCTC
TAGGTTTTTCTGAAATAAAATATTTTTAAAATAAATTTTAGAATTTTTGTTAAATTTATT
AGGGATTTAATTAAATTTTATAATTATGAGTTTATAAAAAGTATTTAGTAATAAAAATAG
AAAAAGAGCTAAAGAAAATTTTAAGAATTTAACTTGAAAATATAGTTTTACGAAATCAAT
TGAGATTTAAACAGTCAAAAAAAATAATAAATAATTTTTATTTCCAGAAAAAATTAATTG
TCTTATTATTTTAACTTAGCTAATTTATTTTTATTGAATAGGATTGTACTTTTATTAGAG
TTTCTGGTAGTGAATTGGTTTAGAAATATATTGGTGAAGGAGCAAGAATGGTCAGAGAAT
TATTCGTCATGGCTAGATAACATGCTCCTTGTTTGATTTTTATTGATGAAGTCGATTCTA
TCGGTGGTGCAAGAATTGATAGTGATAGAGGTGGTGACTCAGAAGTACAAAGAACTATGC
TTGAACTTCTTAACTAAGTAAATAAATTAATAAAAAATATAATTAAAAATGGTATTTTTA
ATTTTTTAAAATTTTTAAATAGCTTGACGGTTTTGAATCTACAAATAACATTAAAATTAT
CATGGCTACTAATCGTATTGATATATTAGATCCTGCTCTTCTTAGACCAGGTCGTATCGA
TAGAAAGGTAGAGTTCCCTAATCCTAGTGTTGAGGTAATTGATAAAACATGATATTTTTT
ATTTAATTATTAAGCATACTATTTATATTTAAAAAATAATTATAAATTTATAGGCTAGAT
TAGAAATCTTATCAATCCACTCAAAGAAAATGAATCTCATGAGAGGTATTAATTTAAAGG
CTATAGCTGAAAAGATGGGAGGAGCTTCTGGTGCAGAATCAAAGGTGAATAATAATTATT
TTATATTTTATTAATTAATATTTTTTTAAATATTTATTATTAGGCTGTATGTACTGAAGC
TGGTATGTTTGCATTAAGAGAAAGAAGAATTCATGTTACTCAAGAAGATTTCGAAATGGC
TGTTTCAAAGGTTATGAAAAAGGACTTAGAAAAAAATATGGCTCTTCGTAAATTATGGAC
ATGA