Identifiers and Description

Gene Model Identifier

TTHERM_00136360

Standard Name

RPT5 (26S proteasome regulatory subunit T5)

Aliases

PreTt24361 | 10.m00552 | 3698.m00129

Description

26S proteasome subunit P45 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( TIGR02880 ) CbbX protein
  • ( PF00004 ) ATPase, AAA family
  • ( TIGR02902 ) ATP-dependent protease LonB
  • ( TIGR02881 ) stage V sporulation protein K
  • ( TIGR01242 ) 26S proteasome subunit P45 family
  • ( TIGR00635 ) Holliday junction DNA helicase RuvB
  • ( TIGR01241 ) ATP-dependent metallopeptidase HflB
  • ( TIGR02237 ) DNA repair and recombination protein
  • ( PF07724 ) ATPase family associated with various
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00136360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000045059.997093137033517e-262locus:rpt-5 status:Confirmed
UniProt:O76371 protein_id
:CCD62966.1
Tetrahymena borealisEI9_05800.19.997093137033517e-26226S proteasome subunit P45 fam
ily protein (437 aa)
DictyBaseDDB_G02844159.997093137033517e-262psmC3 on chromosome: 4 positio
n 1968066 to 1969603
OxytrichaContig19264.0.g579.997093137033517e-262ATPase family associated with
various cellular activities (A
AA)
SGDYOR117W9.997093137033517e-262RPT5 One of six ATPases of the
19S regulatory particle of th
e 26S proteasome involved in t
he degradation of ubiquitinate
d substrates; recruited to the
GAL1-10 promoter region upon
induction of transcription; si
milar to human TBP1
Stentor CoeruleusSteCoe_215481.2479464629129513e-47

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00136360(coding)
ATGGCCAGCAACGTAACTGCAAAATAATAGAATGCCACACCTATGGAATAGGAAGAAGTT
GATCCTACTACCCAATGGTTGAGCGAAATACAAGATCTTACTGATGAATAAATTAGAAAT
AGAACTAAAGATCTTGAAAATAACATTTCTTTAATGAAAAAGGAATTACAAAGAATTAAA
AGTGACACTAACAAGACTACAAAACTTATAAATGACAACAAATCAAAGATTAAAATGAAT
AAGTAGTTACCTTACTTAGTTTCTAATATAGTTGAAATTTTAGATATTGAACCTGAAGAA
GGAGAAGATGAAGACACTGCTACTGTCGATATCAATTCTACTCGTAAAGGAAAAGCTGTT
GTAGTTAAAACTTCAACCAAGTAATCTGTTTTCTTACCCGTTATTGGATTAGTTGATGCT
GAAGAGTTAAAACCTGGTGAGATTGTTGGTGTTAATAAGGATTCATATCTTGTTCTTGAA
AAATTACCTGCTGAATACGATAATAGAGTTAAGGCTATGGAAGTAGATGAGAGACCTACT
GAAAAATACACCGATGTTGGTGGTTTGGATAAGCAAATTGAAGAATTAAGAGAAGCTATC
GTCCTTCCTATTACACACAAAGAAAAATTTGAAAGCATTGGTATTCGTCCTCCTAAAGGT
GTTCTTATGCATGGCCCTCCTGGTACTGGTAAAACTATGATGGCAAGAGCTTGTGCTGCT
GATACCAAAGCCACATTCTTAAAACTTGCAGGTCCTCAACTCGTTTAGATGTTTATTGGT
GATGGTGCCAAAATGATTAGAGATGCCTTTGCATTGGCTCGTGAAAAATCACCTGCTATT
ATATTTATTGATGAACTCGATGCTATTGGTACTAAAAGATTTGACAGTGACAAGAGTGGT
GATCGTGAAGTCCAAAGAACTATGTTAGAATTATTAAACTAGCTTGACGGTTTTTCACCT
GATGATAATATTAAAGTTATTGCCGCTACCAATAGACCTGATATTTTAGATCCAGCTCTT
TTGAGAAGTGGTAGATTAGATAGAAAAATAGAATTCCCTCTTCCTACTGAAGAAGCTAGA
GGTTAAGTTATGAAAATCCATTCTAGAAAAATGAATGTAGCTAAAGATATTAACTTTTCC
GAATTAGCTAGATGCACTGATGGATTTAACTGTGCTTAAATGAAAGCAGTTTGTGTCGAA
GCAGGTATGTGTGCTCTTAGAAGAAGTGCTAGCTTCATTACTCATGAAGATTTCGTTGAT
GGTATAGCAGCAGTAGAAGCTAAAAAGAAAGAAAAATTAGAATATTTTGCTTGA


>TTHERM_00136360(protein)
MASNVTAKQQNATPMEQEEVDPTTQWLSEIQDLTDEQIRNRTKDLENNISLMKKELQRIK
SDTNKTTKLINDNKSKIKMNKQLPYLVSNIVEILDIEPEEGEDEDTATVDINSTRKGKAV
VVKTSTKQSVFLPVIGLVDAEELKPGEIVGVNKDSYLVLEKLPAEYDNRVKAMEVDERPT
EKYTDVGGLDKQIEELREAIVLPITHKEKFESIGIRPPKGVLMHGPPGTGKTMMARACAA
DTKATFLKLAGPQLVQMFIGDGAKMIRDAFALAREKSPAIIFIDELDAIGTKRFDSDKSG
DREVQRTMLELLNQLDGFSPDDNIKVIAATNRPDILDPALLRSGRLDRKIEFPLPTEEAR
GQVMKIHSRKMNVAKDINFSELARCTDGFNCAQMKAVCVEAGMCALRRSASFITHEDFVD
GIAAVEAKKKEKLEYFA


>TTHERM_00136360(gene)
ATGGCCAGCAACGTAACTGCAAAATAATAGAATGCCACACCTATGGAATAGGAAGAAGTT
GATCCTACTACCCAATGGTTGAGCGAAATACAAGATCTTACTGATGAATAAATTAGAAAT
AGAACTAAAGATCTTGAAAATAACATTTCTTTAATGAAAAAGGAATTACAAAGAATTAAA
AGTGACACTAACAAGACTACAAAACTTATAAATGACAACAAATCAAAGATTAAAATGAAT
AAGTAGTTACCTTACTTAGTTTCTAATATAGTTGAAATTTTAGATATTGAACCTGAAGAA
GGAGAAGATGAAGACACTGCTACTGTCGATATCAATTCTACTCGTAAAGGAAAAGCTGTT
GTAGTTAAAACTTCAACCAAGTAATCTGTTTTCTTACCCGTTATTGGATTAGTTGATGCT
GAAGAGTTAAAACCTGGTGAGATTGTTGGTGTTAATAAGGATTCATATCTTGTTCTTGAA
AAATTACCTGCTGAATACGATAATAGAGGTAATTATTTTAGATAAACAAATATATAAATA
AATAACTATTAGTTTGCAATATTAAACAAAATCAAAGATAAACTTAAGATCTTTGAGAAG
AATATTTATTGTTTGGCAATACGAGCCAAGCAATTCATAGAAAGCTTAATGATTTACTTA
GATTTACAATTTGCTTATTGAAAAACGTTTATTTTATATTAGTTCAATAAATAAATCTAA
AATTGGTTTCAATTTATAAAAAAATAGATGTAAAAATAAATAAATAATTAATTAAATAGA
TAGATAATTTGCAAACTAAACAGTTAATTATTTATCAAAAAACTTATTGATTTTTATTTT
AAAATATCAAATTTTAGTTAAGGCTATGGAAGTAGATGAGAGACCTACTGAAAAATACAC
CGATGTTGGTGGTTTGGATAAGCAAATTGAAGAATTAAGAGAAGCTATCGTCCTTCCTAT
TACACACAAAGAAAAATTTGAAAGCATTGGTATTCGTCCTCCTAAAGGTGTTCTTATGCA
TGGCCCTCCTGGTACTGGTAAAACTATGATGGCAAGAGCTTGTGCTGCTGATACCAAAGC
CACATTCTTAAAACTTGCAGGTCCTCAACTCGTTTAGATGTTTATTGGTGATGGTGCCAA
AATGATTAGAGATGCCTTTGCATTGGCTCGTGAAAAATCACCTGCTATTATATTTATTGA
TGAACTCGATGCTATTGGTACTAAAAGGTAATTAACCTAATCATAATATACTTTAGATAT
TTAAAAAATATATGAATTTAATTAAGTCATGCATGATATACTTTAGACACTTAAAATATT
TGAATTTTATCATTTAGCAAGAATATAAACAAACAAAAAAACACACTTAGCATAAAATAT
TTAGCACAAATTAGGGGAAAATTAATTAACATAAAAATTTATAAAATAAAAAGATTTGAC
AGTGACAAGAGTGGTGATCGTGAAGTCCAAAGAACTATGTTAGAATTATTAAACTAGCTT
GACGGTTTTTCACCTGATGATAATATTAAAGTTATTGCCGCTACCAATAGACCTGATATT
TTAGATCCAGCTCTTTTGAGAAGTGGTAGATTAGATAGAAAAATAGAATTCCCTCTTCCT
ACTGAAGAAGCTAGAGGTTAAGTTATGAAAATCCATTCTAGAAAAATGAATGTAGCTAAA
GATATTAACTTTTCCGAATTAGCTAGATGCACTGATGGATTTAACTGTGCTTAAATGAAA
GCAGTTTGTGTCGAAGCAGGTATGTGTGCTCTTAGAAGAAGTGCTAGCTTCATTACTCAT
GAAGATTTCGTTGATGGTATAGCAGCAGTAGAAGCTAAAAAGAAAGAAAAATTAGAATAT
TTTGCTTGA