Identifiers and Description

Gene Model Identifier

TTHERM_00469100

Standard Name

RPT4 (26S proteasome regulatory subunit T4)

Aliases

PreTt18712 | 55.m00267 | 3710.m00115

Description

26S proteasome subunit P45 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF00004 ) ATPase, AAA family
  • ( PF00158 ) Sigma-54 interaction domain
  • ( TIGR02902 ) ATP-dependent protease LonB
  • ( TIGR02881 ) stage V sporulation protein K
  • ( TIGR01242 ) 26S proteasome subunit P45 family
  • ( TIGR01552 ) prevent-host-death family protein
  • ( TIGR00635 ) Holliday junction DNA helicase RuvB
  • ( TIGR01241 ) ATP-dependent metallopeptidase HflB
  • ( TIGR00382 ) ATP-dependent Clp protease, ATP-binding subunit
  • ( PF07724 ) ATPase family associated with various
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00469100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_355370
WormBaseWBGene000045049.997093137033517e-262locus:rpt-4 Probable 26S pro
tease regulatory subunit 10B
status:Confirmed UniProt:O1
7071 protein_id:CCD62358.1
Tetrahymena borealisEI9_15684.19.997093137033517e-26226S proteasome subunit P45 fam
ily protein (391 aa)
OxytrichaContig10954.0.g629.997093137033517e-262ATPase family associated with
various cellular activities (A
AA)
SGDYOR259C8.000959403653794e-177RPT4 One of six ATPases of the
19S regulatory particle of th
e 26S proteasome involved in d
egradation of ubiquitinated su
bstrates; contributes preferen
tially to ERAD; required for s
pindle pole body duplication;
mainly nuclear localization
DictyBaseDDB_G02845174.997692805068281e-176psmC6 on chromosome: 4 positio
n 2090141 to 2091556

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00469100(coding)
ATGGCTTCAACTGATAATCCAGTAGTTTAAAATTACCTTAGAGTTAAGCGTGAACATGAG
AAGATGGAAATCGATTTAAAAAAGCAAAGATTCAACTTACGTGACTTGAATAAGCAATTA
GATAAAACTGATGATTAGCTTAAGGCTATCTAAAGTGTAGGATAACCAATTGGTGAAGTT
TTAAAGCAAATTAATGAAGAAAAATACATTGTTAAATCATCAAGTGGCCCTAGATACGTA
GTTGGTGTTAAATCTAAAATTAATAGAGAAAAGCTTGTTATTGGAGCTAGAGTAGCATTA
GATTAGAATACTTATACTATTGTTAGAATCTTGCCTAGAGAAGTAGATCCTATGGTATAT
CATATGTTACATGAAGATCCAGGTAAAGTTACCTTTGACGATGTCGGTGGTTTAGATGAC
TAAATTAGAACTCTTAGAGAAACTATTGAGTTACCAATCACAAATCCAGAATTGTTTAGA
AGAGTAGGTGTTAAGCCTCCTAAAGGTTGTTTGATGTATGGACCTCCTGGTACTGGTAAA
ACTTTAATTGCAAGAGCTCTTGCCAATAATGTTGATGCAAAATTCTTAAAGGTTGTAGCA
TCAGGTATAGTAGATAAATATATTGGTGAATCTGCAAGAGTTATTCGTGAAATGTTCGCT
TTTGCAAGAGAGCACGAACCATGCATTATATTTATGGATGAAATCGATGCTATTGGTGGT
CGTAGATTTTCAGAAGGTTCTTCTGCTGATAGAGAAATCCAAAGAACTTTGATGGAACTT
CTAAATCAAATTGATGGTTTTGATGATTTAAAGAGAGTCAAGATTGTTATGGCCACAAAT
AGACCCGATGTGCTTGATCCTGCACTTATGAGACCAGGTCGTTTAGATAGAAAAGTAGAA
ATTCCCTTACCTAATGAATAGGCCCGTGCAAAAATTTTAGGCATTCATATGAAAACTATT
ACTATATTAGGTGAAGTAACTTATATTGAAGAACTTGCCAAGCTTACAGAAGATTTCAAT
GGAGCTGATTTACGTAACGTATGTACAGAAGCAGGTATGTTTGCTATTAGAGCTGGTAGA
GATTATGTCATTTAAGAAGATTTCTTCAAGGCTGCTAGAAAGATAAAAGAATCTAAAAAA
TTAGAATCTAAGTTAGATTACAGCAAAGTTTGA


>TTHERM_00469100(protein)
MASTDNPVVQNYLRVKREHEKMEIDLKKQRFNLRDLNKQLDKTDDQLKAIQSVGQPIGEV
LKQINEEKYIVKSSSGPRYVVGVKSKINREKLVIGARVALDQNTYTIVRILPREVDPMVY
HMLHEDPGKVTFDDVGGLDDQIRTLRETIELPITNPELFRRVGVKPPKGCLMYGPPGTGK
TLIARALANNVDAKFLKVVASGIVDKYIGESARVIREMFAFAREHEPCIIFMDEIDAIGG
RRFSEGSSADREIQRTLMELLNQIDGFDDLKRVKIVMATNRPDVLDPALMRPGRLDRKVE
IPLPNEQARAKILGIHMKTITILGEVTYIEELAKLTEDFNGADLRNVCTEAGMFAIRAGR
DYVIQEDFFKAARKIKESKKLESKLDYSKV


>TTHERM_00469100(gene)
ATGGCTTCAACTGATAATCCAGTAGTTTAAAATTACCTTAGAGTTAAGCGTGAACATGAG
AAGATGGAAATCGATTTAAAAAAGCGTAATAATTCTAATTTTATTTATTTAAGTTCAAAG
GCACTTTATTCAATCATTACATATTAAGATTGCTTAATTAATCAATATTGATTAAGACTT
CAAATGAGTGATTTATTAAATATAAAAAATTATTTTTATAAATGAATATAGAAAGATTCA
ACTTACGTGACTTGAATAAGCAATTAGATAAAACTGATGATTAGCTTAAGGCTATCTAAA
GTGTAGGATAACCAATTGGTGAAGTTTTAAAGCAAATTAATGAAGAAAAATGTAAATCTT
TATTAGTTTTGTTTCTTTATGGCAGATCAAAAAAGGTTATGTGACAATAATTTTAAACAA
ATATGAGTGACTGGCCTTTTTTCCTTCATTTTGATGAGCTATTATCCTTAAAATTATATA
AACATATTATTTTATTTATAGACATTGTTAAATCATCAAGTGGCCCTAGATACGTAGTTG
GTGTTAAATCTAAAATTAATAGAGAAAAGCTTGTTATTGGTAAAGAATCAATTTTTTGAA
TTTAAAATATTTTGTTAAGTTAGTTGATGGCTCCTTATTAACAAATATTATTGTTGTTTA
TTATTATAGGAGCTAGAGTAGCATTAGATTAGAATACTTATACTATTGTTAGAATCTTGC
CTAGAGAAGTAGATCCTATGGTATATCATATGTTACATGAAGATCCAGGTAAAGTTACCT
TTGACGATGTCGGTGGTTTAGATGACTAAATTAGAACTCTTAGAGAAGTAATTTATATAT
TTATTTCTATTAATAGAGTTTTTAGTATGCCTCATTTAATAATAAATAAATAATTAAATA
GTTTAACCATTTTAAGCTTTAGCATTTTATTACACACTTACTTAATTAGGAAATAAATAA
CTCCAAACAAATTTTAATGGAAGAAGAAAAATAGATTATTTATTTATAATTAGAATGCTT
ATTAAAATTTCAATAAAATAATAATAATTAAAATTTATTAATTAGACTATTGAGTTACCA
ATCACAAATCCAGAATTGTTTAGAAGAGTAGGTGTTAAGCCTCCTAAAGTAATATTTAGT
TAAAATAAGTTATGAGTCCTAATTAAATTATTCTTATTAGGGTTGTTTGATGTATGGACC
TCCTGGTACTGGTAAAACTTTAATTGCAAGAGCTCTTGCCAATAATGTTGATGCAAAATT
CTTAAAGGTTGTAGCATCAGGTATAGTAGATAAATATATTGGTGAATCTGCAAGAGTTAT
TCGTGAAATGTTCGCTTTTGCAAGAGAGCACGAACCATGCATTATATTTATGGATGAAAT
CGATGCTATTGGTGGTCGTAGATTTTCAGAAGGTTCTTCTGCTGATAGAGAAATCCAAAG
AACTTTGATGGAAGTAAAAAAAAATTCATTGTTTAAAATTAGAAATTTAATTTAATAAAA
TTAATTTAAAAAAATAGCTTCTAAATCAAATTGATGGTTTTGATGATTTAAAGAGAGTCA
AGATTGTTATGGCCACAAATAGACCCGATGTGCTTGATCCTGCACTTATGAGACCAGGTC
GTTTAGATAGAAAAGTAGAAATTCCCTTACCTAATGAATAGGCCCGTGCAAAAATTTTAG
GCATTCATATGAAAACTATTACTATATTAGGTGAAGTAACTTATATTGAAGAACTTGCCA
AGCTTACAGAAGATTTCAATGGAGCTGATTTACGTAACGTATGTACAGAAGCAGGTAAAA
TAAAAATAATAAATGATAAACCTAGTTTAAAATGAATATTATTGAAATAAAAATATAGGT
ATGTTTGCTATTAGAGCTGGTAGAGATTATGTCATTTAAGAAGATTTCTTCAAGGCTGCT
AGAAAGATAAAAGAATCTAAAAAATTAGAATCTAAGTTAGATTACAGCAAAGTTTGA