Identifiers and Description

Gene Model Identifier

TTHERM_00068110

Standard Name

RPT3 (26S proteasome regulatory subunit T3)

Aliases

PreTt13200 | 4.m00599 | 3707.m00236

Description

26S proteasome subunit P45 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( TIGR02880 ) CbbX protein
  • ( PF00004 ) ATPase, AAA family
  • ( PF08544 ) GHMP kinases C terminal
  • ( TIGR02881 ) stage V sporulation protein K
  • ( TIGR01242 ) 26S proteasome subunit P45 family
  • ( TIGR01241 ) ATP-dependent metallopeptidase HflB
  • ( TIGR01526 ) nicotinamide-nucleotide adenylyltransferase
  • ( TIGR01313 ) carbohydrate kinase, thermoresistant glucokinase family
  • ( PF07724 ) ATPase family associated with various
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00068110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_130180
WormBaseWBGene000045039.997093137033517e-262locus:rpt-3 Probable 26S pro
tease regulatory subunit 6B
status:Confirmed UniProt:P46
502 protein_id:CCD69926.1
Tetrahymena borealisEI9_02110.19.997093137033517e-26226S proteasome subunit P45 fam
ily protein (402 aa)
DictyBaseDDB_G02890039.997093137033517e-262psmC4 on chromosome: 5 positio
n 2227887 to 2229274
SGDYDR394W9.997093137033517e-262RPT3 One of six ATPases of the
19S regulatory particle of th
e 26S proteasome involved in t
he degradation of ubiquitinate
d substrates; substrate of N-a
cetyltransferase B
OxytrichaContig12666.0.1.g292.000339145488238e-180ATPase family associated with
various cellular activities (A
AA)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00068110(coding)
ATGGAAATTGAAAAGACTGGATAAGCTGCTGCTCCTACCAATCTCAATGATTTAAGTGAG
CAAGATTTATATCAAAAAATGAAAGAATTAGAAAAGGAATTAGAATTCCTTGATATCTAA
GAAGAATTCATTAAGGATGATTAAAAGAAGTTAAAGAGAGAGTTAGTTCGTTCAAAGGAA
GAATTAAAGAGAATTCAATCTACACCTCTTGTTATTGGTCACTTCATTGAAATGATTGAT
GAATTGCACGCATTAGTTTCATCATCTGGTGGTTCTACATACTATGTTAGAGTTCTCTCT
ACTTTAGATAGAGAATTATTGAAACCCTCAACAAGTATTGCACTTCATCGTCATTCTCAC
TCTGTTGTAGATATCCTTCCAAGTGAATCTGATTCTTCAATTTAAATGATGAAAGTTACT
GAAAAACCCGATGTTTCTTATCAAGATATTGGTGGTTTAGATCAATAAAAGTAAGAAATG
AAAGAAGCAGTAGAACTTCCTTTAACATATCCTGAATTGTATCAATAAATTGGTATCGAC
CCTCCAAGAGGTGTTTTAATGTATGGTCCTCCTGGTACTGGTAAAACTATGATGGCAAAA
GCTGTTGCTCACCATACTACAGCTGCTTTTATTAGAGTAGTTGGTTCTGAATTCGTATAA
AAATATCTTGGTGAAGGCCCTAGAATGGTCAGAGATGTCTTTAAACTTGCCAGAGAAAAT
GCTCCTTCTATTATATTTATTGATGAAGTCGATGCTATTGCTACCAAACGTTTTGATGCT
TAAACTGGTGCTGATAGAGAAGTTTAAAGAGTTTTAATTGAAATGCTTAACTAAATGGAT
GGTTTCGATCAAACTACAAATGTCAAAGTTATTATGGCAACTAATAGATCAGATACTCTT
GATCCTGCCCTTCTTCGTCCTGGTAGACTTGATAGAAAGATTGAATTCCCTCTTCCTGAT
AGAAGACAAAAGCGTCTTATTTTCTAAACTGTTACAGCAAAGATGAACTTATCTGAAGAT
GTTGATCTTGAAGCATATGTTAGCAGACCCGATAAAATTTGTTGTGCTGATATATCTGCA
ATTTGTTAAGAAGCTGGTATGCAAGCAGTTAGAAAGAACAGATATGTTGTTACATAAAAA
GATTTCGATAAGGCTTATAAGATAGTCATTAGAAAATCAGAAAGAGAATTTAATTTCTAC
AAGTGA


>TTHERM_00068110(protein)
MEIEKTGQAAAPTNLNDLSEQDLYQKMKELEKELEFLDIQEEFIKDDQKKLKRELVRSKE
ELKRIQSTPLVIGHFIEMIDELHALVSSSGGSTYYVRVLSTLDRELLKPSTSIALHRHSH
SVVDILPSESDSSIQMMKVTEKPDVSYQDIGGLDQQKQEMKEAVELPLTYPELYQQIGID
PPRGVLMYGPPGTGKTMMAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFKLAREN
APSIIFIDEVDAIATKRFDAQTGADREVQRVLIEMLNQMDGFDQTTNVKVIMATNRSDTL
DPALLRPGRLDRKIEFPLPDRRQKRLIFQTVTAKMNLSEDVDLEAYVSRPDKICCADISA
ICQEAGMQAVRKNRYVVTQKDFDKAYKIVIRKSEREFNFYK


>TTHERM_00068110(gene)
ATGGAAATTGAAAAGACTGGATAAGCTGCTGCTCCTACCAATCTCAATGTAAATTAAAAT
TAAATTTGGAATCACAAGAATTCAGTTATCAATTATTTGGTGTTGTAGATTTTGGGGAAT
AAGCAAAAATTTAGAAAATCAAAAATCATTTTATGAAAACTTAACATTATTTGTTTAAAC
GAAGCATATAGATAGTAATCAAAATTATGAAAGTATAAAAGTTTTATCTATAAAATATTA
TAGGATTTAAGTGAGCAAGATTTATATCAAAAAATGAAAGAATTAGAAAAGGAATTAGAA
TTCCTTGATATCTAAGAAGAATTCATTAAGGATGATTAAAAGAAGTTAAAGAGAGAGTTA
GTTCGTTCAAAGGAAGAATTAAAGAGAATTCAATCTACACCTCTTGTTATTGGTCACTTC
ATTGAAATGATTGATGAATTGCACGCATTAGTTTCATCATCTGGTGGTTCTACATACTAT
GTTAGAGTTCTCTCTACTTTAGATAGAGAATTATTGAAACCCTCAACAAGTATTGCACTT
CATCGTCATTCTCACTCTGTTGTAGATATCCTTCCAAGTGAATCTGATTCTTCAATTTAA
ATGATGAAAGTTACTGGTAAATATATATTTAAAGGCATTATTTTTAATGAGTAAAAGCTA
AGCTATCATATTATAATAGTTCAGATGCTTATTGTATAAGTTTCAAATAGGAAATAGGAT
AAATTTACACAATATATTTAGAATTAGAATAAGAAATATCAACAAAACTTGACAAAATTT
GTGAAATATTTTGATAATAATTTATGATGACTGAAGTCTACTACTTATTGATTAATTTAT
TTAATAGAAACAAAATAAATAAATAAACAAATAATCAAGCAATCTAATAATAAATAAAAA
GAAAATTAAAAGCTAAGATATTTTTTAAATTATTATTTTTTTCAATATATGAATTACAAA
CTCTCTATTGTCTTCAGAATAGATACGTTTAAAATAGGAACTAAAAATTTTAAATAAATT
AATTAGTTTATAGAAATGTTTTAGCTCATATCAAAATACTTAAAATAAATAATTCTCAAT
TAAGCTAAAATCTTTTAAAAATAAATAAATTTAATTAAAAAATAGAAAAACCCGATGTTT
CTTATCAAGATATTGGTGGTTTAGATCAATAAAAGTAAGAAATGAAAGAAGCAGTAGAAC
TTCCTTTAACATATCCTGAATTGTATCAATAAATTGGTATCGACCCTCCAAGAGGTGTTT
TAATGTATGGTCCTCCTGGTACTGGTAAAACTATGATGGCAAAAGCTGTTGCTCACCATA
CTACAGCTGCTTTTATTAGAGTAGTTGGTTCTGAATTCGTATAAAAATATCTTGGTGAAG
GCCCTAGAATGGTCAGAGATGTCTTTAAACTTGCCAGAGAAAATGCTCCTTCTATTATAT
TTATTGATGAAGTCGATGCTATTGCTACCAAACGTTTTGATGCTTAAACTGGTGCTGATA
GGTAATTAATTAAAAATTTAAAAATAATATTTATGTTTTACATTACTGTTATTTAAAATT
ACAGAGAAGTTTAAAGAGTTTTAATTGAAATGCTTAACTAAATGGATGGTTTCGATCAAA
CTACAAATGTCAAAGTTATTATGGCAACTAATAGATCAGATACTCTTGATCCTGCCCTTC
TTCGTCCTGGTAGACTTGATAGAAAGATTGAATTCCCTCTTCCTGATAGAAGACAAAAGC
GTCTTATTTTCTAAACTGTTACAGCAAAGATGAACTTATCTGAAGATGTTGATCTTGAAG
CATGTATTAAAATCTTATTTAATTAAATTAAGGGTTAAATATATTTTTAAATTAATTTAG
ATGTTAGCAGACCCGATAAAATTTGTTGTGCTGATATATCTGCAATTTGTTAAGAAGCTG
GTATGCAAGCAGTTAGAAAGAACAGGTAATTTAAATTTAGCAGTTAAAGATTAGAAGTTA
GTTTTTACAATTATTTCATAATTAAAATAGATATGTTGTTACATAAAAAGATTTCGATAA
GGCTTATAAGATAGTCATTAGAAAATCAGAAAGAGAATTTAATTTCTACAAGTGA