Identifiers and Description

Gene Model Identifier

TTHERM_01014660

Standard Name

RPT2 (26S proteasome regulatory subunit T2)

Aliases

PreTt04596 | 197.m00070 | 3748.m00306

Description

26S proteasome subunit P45 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01014660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20221.19.997093137033517e-26226S proteasome subunit P45 fam
ily protein (666 aa)
OxytrichaContig10146.0.g491.9991517704232713e-32DHHC palmitoyltransferase
DictyBaseDDB_G02877299.996273942859018e-26DDB_G0287729 on chromosome: 5
position 613467 to 615948
WormBaseWBGene000127185.998633383648922e-18locus:dhhc-8 Palmitoyltransf
erase status:Partially_confi
rmed UniProt:Q9U2K0 protei
n_id:CAB54433.3
SGDYLR246W0.000000000000001999258566166494ERF2 Subunit of a palmitoyltra
nsferase, composed of Erf2p an
d Shr5p, that adds a palmitoyl
lipid moiety to heterolipidat
ed substrates such as Ras1p an
d Ras2p through a thioester li
nkage; mutants partially mislo
calize Ras2p to the vacuole
Stentor CoeruleusSteCoe_67430.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_01014660(coding)
ATGATACCAGAAAAAAATATTAAAAACTCTGTTGAATGTTTTTCTGGGATGCAGTTACCA
AAAAATTATTCAGAAGCAATAAAGTTTCTAAAAAGTCTATCTAATCAATAAAATGTTAAA
CTAGATTACATTGTTGAAATCTTAAAGGTTTATAAAGGCATAAACTTGAATAAATTTCCA
AAATTTAATTTGTTAGTTTAAGCAGTGAAGGATAATAATGAATTTGCTTTTAATCTTTTC
TTAGATTATTTATAATAAGCTGATATTCCATAAGAAGACAAAATTGAATATATAAATAGC
AATAAAGCTTTGAATTGTGAGGAAGGATATAATGCTCTATAATACGCCGTATATTATGAA
TTTTAGGATATGGCTCTCAAATTGATAGAAAAAGGAGCGCGTTACGATACTCATATTAAT
GAAATAGGTGATAAAATTATTCATTCTGCTGCAAGAGGAGGATCTCTTAAAGTTATTATG
AAACTTCAGCAACTAGGTGTAGATATATTTGAAAAGACATAAAGTAAGGGTTTAAATCTC
TCAACATTTGAGATTGCTTGCTTTGAAGGAAATCTTCACATAATGAAATATCTGCTTAAG
ATGGATGAATTTGAAAATTAAAAGAGAATAGATATTAATGAATAACATCCTGTATCAAAA
GAAACACCATTACATTTAGGAATACGTAGTAAAGATTATTCAGTTGTTAAATTTCTGCTA
ATACAGGGTGCAAATAAACAATTAAAAAATAATGAGAATTAGACACCTCTCTAATTTGCT
ATTTGGAGGAAAGAAAAAATATAAAAAAAGTTAAAAGAAAAAAGAGAAACTGTAGATTAA
TATTAAATAATGGAATGGGAAAGCAAAATAAATCATTTGGACTCATTAATTTCTCTACTG
GGAGATATTAAATTTTTTAACCGACTAAAATTATAGACTAGAGTAGGTCCAACAAAAGGC
ATGAATAAATACTCTTATATTCTCAGAATTATTAACATTTTAGGATTTATTGGGTTCATC
TTTATTTTACCATATACTGATTTATTTATAGGATTTATAGTCTTTTTCTATAGTATTTAC
TTATGTTCTTTCTATTGCTTATTCTGCTCTTATAAAAGCGATCCAGGCTATATTAAACAA
TTAGGTTACGAAAGCTATTAACTTGATTTAAACAACAATTAACCTGCTTCATAAAAAGAT
ACTTTTGTGAATAATTTTTGGTTACTATTATGCAAGAAAGAGTTTGAGGAGCTTTGTTTA
GAATGTTGTATTATAAAACCAGTTAGATCAAAACATTGTGATTTTTGTAACAGATGTGTT
GCCGTTATGGACCATCACTGTCCCTTCATAAAAAATTGTGTTGGAGCGAAAAATCACAGA
TATTTCTTTTTTATGCTAGTAACATAAGCATTGTCTTAGATTTCTATCCTTATTGCGTGT
ATTTTTGCTCTAAAAGAGCTCTAGTAAGATGATATAGAAGATGAGCACTCTCATCAATTT
ATAGATTCTTGCCCATAGTTATTTAATCCAATTATTGCTTATATTAGTATTTCAATTTTA
ATAATTTAATTTATTATAACTTGCTTTCCGTTGTTCTTCATTATCATTCATCAAAGGACT
ATCCTTGTTAATGGTTTGACTTCTCTTGAAATGAGGTATAAAGGAAAATTTGATAAACAA
AAAAAAGAAGAAATAGATGAAAATTAACCTGTAACAGAAGTTCCTAACAGAACTAAATCT
AAGTAACATCCTGAAACTCGCTCTAATTCTACATCATAATCTACAGCTCGTCTTTCTCAT
TCAAATATAAATGATGATTAAGAAGATGAATAACCTGAAATTACAGAAGACCAGCTTGAA
AGTACAGACGATTAAGACACGGGATCACTATACACTGCGCTTTCTGCACAGCAAAGAGAT
ATATTTCAAAATAGAAATACAAACCCATCAAATAAAAAGTGGTATGAAAATATAAAGTGT
ATGCTCTTTAAGAATCGCAAAAATAAATTTTATTTTGCTGACGAAGAGTTGCATAGAAGA
ATATTTTAGAATCAAGATTAAAGATTTAGTCTAAGCTGTTCTCAGTAATTTTCTGAAAAG
GATTGCTTAAGTAAAACTGAAAGCAGAAATTAGCTTCTAATGTAATACATTAAATGA


>TTHERM_01014660(protein)
MIPEKNIKNSVECFSGMQLPKNYSEAIKFLKSLSNQQNVKLDYIVEILKVYKGINLNKFP
KFNLLVQAVKDNNEFAFNLFLDYLQQADIPQEDKIEYINSNKALNCEEGYNALQYAVYYE
FQDMALKLIEKGARYDTHINEIGDKIIHSAARGGSLKVIMKLQQLGVDIFEKTQSKGLNL
STFEIACFEGNLHIMKYLLKMDEFENQKRIDINEQHPVSKETPLHLGIRSKDYSVVKFLL
IQGANKQLKNNENQTPLQFAIWRKEKIQKKLKEKRETVDQYQIMEWESKINHLDSLISLL
GDIKFFNRLKLQTRVGPTKGMNKYSYILRIINILGFIGFIFILPYTDLFIGFIVFFYSIY
LCSFYCLFCSYKSDPGYIKQLGYESYQLDLNNNQPASQKDTFVNNFWLLLCKKEFEELCL
ECCIIKPVRSKHCDFCNRCVAVMDHHCPFIKNCVGAKNHRYFFFMLVTQALSQISILIAC
IFALKELQQDDIEDEHSHQFIDSCPQLFNPIIAYISISILIIQFIITCFPLFFIIIHQRT
ILVNGLTSLEMRYKGKFDKQKKEEIDENQPVTEVPNRTKSKQHPETRSNSTSQSTARLSH
SNINDDQEDEQPEITEDQLESTDDQDTGSLYTALSAQQRDIFQNRNTNPSNKKWYENIKC
MLFKNRKNKFYFADEELHRRIFQNQDQRFSLSCSQQFSEKDCLSKTESRNQLLMQYIK


>TTHERM_01014660(gene)
ATGATACCAGAAAAAAATATTAAAAACTCTGTTGAATGTTTTTCTGGGATGCAGTTACCA
AAAAATTATTCAGAAGCAATAAAGTTTCTAAAAAGTCTATCTAATCAATAAAATGTTAAA
CTAGATTACATTGTTGAAATCTTAAAGGTTTATAAAGGCATAAACTTGAATAAATTTCCA
AAATTTAATTGTAAATTCTTAGATTGTTTTTGTTTTCCTATTTACATATAAAAACTATCA
ATATAAAATCTAATTAAAATGATTAACTGCAATTTATAGTTTGATTATTTTATTTATTTT
AAATATAAATTATTTTTATTATTAGTGTTAGTTTAAGCAGTGAAGGATAATAATGAATTT
GCTTTTAATCTTTTCTTAGATTATTTATAATAAGCTGATATTCCATAAGAAGACAAAATT
GAATATATAAATAGCAATAAAGCTTTGAATTGTGAGGAAGGATATAATGCTCTATAATAC
GCCGTATATTATGAATTTTAGGTAGTTTTAAATAATTTATTAGATTTATTTTATTTTCAA
CTATCACTATCATAGCTTAAACTATGTTATCAATCAATATTGTCTAAAAACCGGTATTTT
ATTTAAAAATTTTTAAAAATAAAGGATATGGCTCTCAAATTGATAGAAAAAGGAGCGCGT
TACGATACTCATATTAATGAAATAGGTATTCAAATAATTTTATATTTAGAATTTCTAAAA
TTAAAAATGTCGCTGTTTGTTTTACTTCTTATTTTAATATATAAATAATTTTTCTTTCTT
TAACTAAAAATTTTGCATTAATTTAATATTTTATGGAAAATAAATAGAATTTTTCTACTA
TATTTTTAACCCTAATTAAAAACAAAATATTTAGGTGATAAAATTATTCATTCTGCTGCA
AGAGGAGGATCTCTTAAAGTTATTGTAAGTAATTATATATTAATTTTGCTTGTTTAACAA
AATATTCTAAAATTAGATGAAACTTCAGCAACTAGGTGTAGATATATTTGAAAAGACATA
AAGTAAGGGTTTAAATCTCTCAACATTTGAGATTGCTTGCTTTGAAGGAAATCTTCACAT
AATGAAATATCTGCTTAAGATGGATGAATTTGAAAATTAAAAGAGAATAGATATTAATGA
ATAACATCCTGTATCAAAAGAAACACCATTACATTTAGGAATACGTAGTAAAGATTATTC
AGTTGTTAAATTTCTGCTAATACAGGGTGCAAATAAACAATTAAAAAATAATGAGAATTA
GACACCTCTCTAATTTGCTATTTGGAGGAAAGAAAAAATATAAAAAAAGTTAAAAGAAAA
AAGAGAAACTGTAGATTAATATTAAATAATGGAATGGGAAAGCAAAATAAATCATTTGGA
CTCATTAATTTCTCTACTGGGAGATATTAAATTTTTTAACCGACTAAAATTATAGACTAG
AGTAGGTCCAACAAAAGGCATGAATAAATACTCTTATATTCTCAGAATTATTAACATTTT
AGGATTTATTGGGTTCATCTTTATTTTACCATGTAAACTAACAAACTATTAATTCAACTA
ACTTATCAACAGTCAAACAAATTCTAAATATTATTTTTTTAATTAATTAATAGATACTGA
TTTATTTATAGGATTTATAGTCTTTTTCTATAGTATTTACTTATGTTCTTTCTATTGCTT
ATTCTGCTCTTATAAAAGCGATCCAGGCTATATTAAACAATTAGGTTACGAAAGCTATTA
ACTTGATTTAAACAACAATTAACCTGCTTCATAAAAAGATACTTTTGTGAATAATTTTTG
GTTACTATTATGCAAGAAAGAGTTTGAGGAGCTTTGTTTAGAATGTTGTATTATAAAACC
AGTTAGATCAAAACATTGTGATTTTTGTAACAGATGTGTTGCCGTTATGGACCATCACTG
TCCCTTCATAAAAAATTGTGTTGGAGCGAAGTAATATTTTCTATTTTTTTCCCAAAGTCA
ATATTCAGTAATCATTTCATTTAAAATATAGAAATCACAGATATTTCTTTTTTATGCTAG
TAACATAAGCATTGTCTTAGATTTCTATCCTTATTGCGTGTATTTTTGCTCTAAAAGAGC
TCTAGTAAGATGATATAGAAGATGAGCACTCTCATCAATTTATAGATTCTTGCCCATAGT
TATTTAATCCAATTATTGCTTATATTAGTATTTCAATTTTAATAATTTAATTTATTATAA
CTTGCTTTCCGTTGTTCTTCATTATCATTCATCAAAGGACTATCCTTGTTAATGGTTTGA
CTTCTCTTGAAATGAGGTATAAAGGAAAATTTGATAAACAAAAAAAAGAAGAAATAGATG
AAAATTAACCTGTAACAGAAGTTCCTAACAGAACTAAATCTAAGTAACATCCTGAAACTC
GCTCTAATTCTACATCATAATCTACAGCTCGTCTTTCTCATTCAAATATAAATGATGATT
AAGAAGATGAATAACCTGAAATTACAGAAGACCAGCTTGAAAGTACAGACGATTAAGACA
CGGGATCACTATACACTGCGCTTTCTGCACAGCAAAGAGATATATTTCAAAATAGAAATA
CAAACCCATCAAATAAAAAGTGGTATGAAAATATAAAGTGTATGCTCTTTAAGAATCGCA
AAAATAAATTTTATTTTGCTGACGAAGAGTTGCATAGAAGAATATTTTAGAATCAAGATT
AAAGATTTAGTCTAAGCTGTTCTCAGTAATTTTCTGAAAAGGATTGCTTAAGTAAAACTG
AAAGCAGAAATTAGCTTCTAATGTAATACATTAAATGA