Identifiers and Description

Gene Model Identifier

TTHERM_00279670

Standard Name

RPT1 (26S proteasome regulatory subunit T1)

Aliases

PreTt04810 | 25.m00274 | 3694.m00059

Description

26S proteasome subunit P45 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( TIGR02880 ) CbbX protein
  • ( PF00004 ) ATPase, AAA family
  • ( PF00158 ) Sigma-54 interaction domain
  • ( TIGR02881 ) stage V sporulation protein K
  • ( TIGR01242 ) 26S proteasome subunit P45 family
  • ( TIGR01241 ) ATP-dependent metallopeptidase HflB
  • ( TIGR02237 ) DNA repair and recombination protein
  • ( TIGR02928 ) orc1/cdc6 family replication initiation protein
  • ( TIGR00382 ) ATP-dependent Clp protease, ATP-binding subunit
  • ( PF07724 ) ATPase family associated with various
  • ( PF07726 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00279670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_314560
WormBaseWBGene000045019.997093137033517e-262locus:rpt-1 26S protease reg
ulatory subunit 7 status:Con
firmed UniProt:Q18787 prot
ein_id:CAB01414.1
Tetrahymena borealisEI9_08919.19.997093137033517e-26226S proteasome subunit P45 fam
ily protein (432 aa)
DictyBaseDDB_G02769179.997093137033517e-262psmC2 on chromosome: 2 positio
n 7234040 to 7235588
OxytrichaContig11163.0.g19.997093137033517e-262ATPase family associated with
various cellular activities (A
AA)
SGDYKL145W9.997093137033517e-262RPT1 One of six ATPases of the
19S regulatory particle of th
e 26S proteasome involved in t
he degradation of ubiquitinate
d substrates; required for opt
imal CDC20 transcription; inte
racts with Rpn12p and Ubr1p; m
utant has aneuploidy tolerance

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00279670(coding)
ATGGCTCCTAGCGCAAACGACAAAGATAATTAACAAGGTGAAGAAAAAAAGCACATCCCT
TTGGATGAAGGTGATATTTCTTTATTGAAAGTTTATGGCATGGGTCCATATGCAGAATCC
ATTAAATCAACTGAAGAAGAAAATAAGAATTTAGTAGTAAAAATTAACAAACTATGCGGT
ATAAAAGAGAGTGATACAGGTCTTTCTTTACCTTCTTAATGGGATTTGAAGGGTGATGAA
ATTAGATTGTCTTAATAACATTCTTTACAAGTCGCTCGTTGCAATAAAATCATTCCTGGT
GACTAACCCACTGAAAATAAATACATGATTAGCATCAAGCAAATGGCCAAATTCGTTGTA
GGTTTAGGTGATAAGCTAGCTCCTACCGATATTGATGAAGGTATGAGAGTTGGTGTTGAG
AAATAAAAATATTCTATTCAACTTCCTCTTCCTCCTAAAATTGATCCTTCAGTCACCATG
ATGACTGTAGAAGAAAAACCTGATGTTACTTATTCAGATATTGGTGGTGCTAATGAATAA
TTAGATCGTCTTAAGGAAGTTGTAGAAATGCCTTTACTCTAGCCTGAAAAGTTTATTGAA
TTGGGTATTGATCCTCCTAAAGGTGTTTTACTCTATGGTCCTCCTGGTACTGGTAAAACC
TTAACTGCAAGAGCCGTTGCCAACAGAACAGATGCCTGCTTCATCCGTGTCATCGGTTCA
GAACTTGTTTAAAGATATGTTGGTGAAGGTGCAAGAATGGTTAGAGAAATCTTCTAGTTA
GCAAGAACCAAGAAAGCTTGTATCATTTTCTTCGATGAAATCGATGCTATTGGTGGTGCT
AGACATGATGACGGTGCTGGTAGTGATAATGAAGTCTAACGTACTATGCTTGAAATCGTA
AATTAATTGGATGGCTTTGAAAGCAGAGGTAACATTAAAGTTTTGATGGCTACAAATAGA
CCTGATACTTTAGATCCCGCTTTGTTAAGACCTGGTAGATTAGATAGAAAGGTTGAATTC
GGTCTTCCAGACTTAGAAGGCAGAACTCACATTTTTAAAATTCATGCCAGACACATGAGT
ATGGAAAAAAATATTCGTTATGAATTATTAGCAAGATTATGCCCTAACACCACTGGTGCT
GATCTTAGATCTGTCTGCACTGAAGCTGGTATGTTCGCCATTAGAGCAAGAAGAAAAGCC
ATCTCTGAAAAGGACCTTCTAGAAGCTATTGAAAAGGTTATAAAAGGATATTCTAAATTC
TCTGCAACTGGCAAATATTTAGTTTATAATTGA


>TTHERM_00279670(protein)
MAPSANDKDNQQGEEKKHIPLDEGDISLLKVYGMGPYAESIKSTEEENKNLVVKINKLCG
IKESDTGLSLPSQWDLKGDEIRLSQQHSLQVARCNKIIPGDQPTENKYMISIKQMAKFVV
GLGDKLAPTDIDEGMRVGVEKQKYSIQLPLPPKIDPSVTMMTVEEKPDVTYSDIGGANEQ
LDRLKEVVEMPLLQPEKFIELGIDPPKGVLLYGPPGTGKTLTARAVANRTDACFIRVIGS
ELVQRYVGEGARMVREIFQLARTKKACIIFFDEIDAIGGARHDDGAGSDNEVQRTMLEIV
NQLDGFESRGNIKVLMATNRPDTLDPALLRPGRLDRKVEFGLPDLEGRTHIFKIHARHMS
MEKNIRYELLARLCPNTTGADLRSVCTEAGMFAIRARRKAISEKDLLEAIEKVIKGYSKF
SATGKYLVYN


>TTHERM_00279670(gene)
ATGGCTCCTAGCGCAAACGACAAAGATAATTAACAAGGTGAAGAAAAAAAGCACATCCCT
TTGGATGAAGGTGATATTTCTTTATTGAAAGTTTATGGCATGGGTCCATATGCAGAATCC
ATTAAATCAACTGAAGAAGAAAATAAGAATTTAGTAGTAAAAATTAACAAACTATGCGGT
ATAAAAGAGAGTGATACAGGTCTTTCTTTACCTTCTTAATGGGATTTGAAGGGTGATGAA
ATTAGATTGTCTTAATAACATTCTTTACAAGTCGCTCGTTGCAATAAAATCATTCCTGGT
GACTAACCCACTGAAAATAAATACATGATTAGCATCAAGCAAATGGCCAAATTCGTTGTA
GGTTTAGGTGATAAGCTAGCTCCTACCGATATTGATGAAGGTATGAGAGTTGGTGTTGAG
AAATAAAAATATTCTATTCAACTTCCTCTTCCTCCTAAAATTGATCCTTCAGTCACCATG
ATGACTGTAGAAGAAAAACCTGATGTTACTTATTCAGATATTGGTGGTGCTAATGAATAA
TTAGATCGTCTTAAGGTAATTAATTCATTTTAAAAAATAATATAAATCAAAGGAGATGCA
TGCATAAATTTGATATTTCAAAGCAGTAACGAAGTTAGAATGAATAGCGGTATTTTCCTA
TCTAAAATAATAAAGAAATTAAGAAAAAGCATAATCATTTCAGAAAAATATGCATTTATT
TTGAAGATTTTAATAAAAACACTTAGTTTAAATATTTAAACTAAAAAATATGGTTTTTGC
TTTGAAGCATTTATTTATTAACAATAAATAAAAAAGCAAATTAAAATAAGATTTTTATTT
ATTGCATTTTTTATTAATTGAATTGATATTTAACCAATTTATTCCCTTGAATAATAAATA
GGAAGTTGTAGAAATGCCTTTACTCTAGCCTGAAAAGTTTATTGAATTGGGTATTGATCC
TCCTAAAGGTGTTTTACTCTATGGTCCTCCTGGTACTGGTAAAACCTTAACTGCAAGAGC
CGTTGCCAACAGAACAGATGCCTGCTTCATCCGTGTCATCGGTTCAGAACTTGTTTAAAG
ATATGTTGGTGAAGGTGCAAGAATGGTTAGAGAAATCTTCTAGTTAGCAAGAACCAAGAA
AGCTTGTATCATTTTCTTCGATGAAATCGATGCTATGTAATTAAATTAAATATAAACACT
TTCTAAGCATTCAAGCCAAATTTTCAAAATTTATAAATAAACTTTTGATTAACTCATTAT
AATATTTTTTTAAATAATTAATTAATTAATTAATTTAGTGGTGGTGCTAGACATGATGAC
GGTGCTGGTAGTGATAATGAAGTCTAACGTACTATGCTTGAAATCGTAAATTAATTGGAT
GGCTTTGAAAGCAGAGGTAACATTAAAGTTTTGATGGCTACAAATAGACCTGATACTTTA
GATCCCGCTTTGTTAAGACCTGGTAGATTAGATAGAAAGGTTGAATTCGGTCTTCCAGAC
TTAGAAGGCAGAACTCACATTTTTAAAATTCATGCCAGACACATGAGTATGGAAAAAAAT
ATTCGTTATGAATTATTAGCAAGATTATGCCCTAACACCACTGGTGCTGATCTTAGATCT
GTCTGCACTGAAGCTGGTATGTTCGCCATTAGAGCAAGAAGAAAAGCCATCTCTGAAAAG
GACCTTCTAGAAGCTATTGAAAAGGTTATAAAAGGATATTCTAAATTCTCTGCAACTGGC
AAATATTTAGTTTATAATTGA