Identifiers and Description

Gene Model Identifier

TTHERM_00434070

Standard Name

RPS9 (Ribosomal Protein of the Small subunit 9)

Aliases

PreTt26548 | 48.m00311 | 3831.m01643

Description

Homolog of yeast RPS9, human RPS9, bacterial RPS4;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00434070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04232.19.999664388307901e-124ribosomal protein S4 containin
g protein (182 aa)
SGDYPL081W4.999773105566236e-81RPS9A Protein component of the
small (40S) ribosomal subunit
; nearly identical to Rps9Bp a
nd has similarity to E. coli S
4 and rat S9 ribosomal protein
s
DictyBaseDDB_G02898778.996246542595932e-80rps9 on chromosome: 5 position
3486480 to 3487388
WormBaseWBGene000044782.0001503375893664e-79locus:rps-9 40S ribosomal pr
otein S9 status:Confirmed
UniProt:Q20228 protein_id:CA
A93262.1
OxytrichaContig18343.0.g852.0001503375893664e-79Ribosomal protein S4/S9 N-term
inal domain
Stentor CoeruleusSteCoe_230971.6458114310822737e-38

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00434070(coding)
ATGATAAAATATAAGGGGAGAAAATTAGTTGGAATAAATTTAAAAGAAAAATTTTGGGCG
TGTGGGGAGGAAAGTACAAAGATAATTTAAAGAGAAAAGTACAGCATCTAAATCAAAGTA
TTATCTAAAGTCAAATAAAAGATATATAAAACCAAAAGTATATAAATAAAAATGGGTAAA
ACCTACATCAACACTTCCAAGACCTACTCTACCCCCAGAAGACCTTATGAAAAGGAAAGA
CTCGATAATGAAATGAAGCTTATCGGTACTTTCGGTTTAAAGAACAAGAGAGAAGTCTGG
AGAGTTTAAATGATCTTGGCTAAGTTCAGAAAGGCTGCTAGAGAATTGCTCACCTTAGAC
CCCAAGGACCCCAGAAGATTATTCGAAGGTTCCGCCCTTTTAAGAAGAATGTTCAAATAC
GGTCTCCTCAGTGAATAAGAAAGAAAGTTGGATTACGTCTTGGGTTTGACCATTCACAAG
CTCATGGAAAGAAGACTCCAAACCAGAGTTTTCAAGTTAAATTTGGCTAACTCTATCCAC
CATTCCAGAGTCCTTATTAGACAAAGACACATCAAGGTTGGTAAGAACTTAGTCAATGTT
CCTTCCTTCATGGTTAGAACTGACTCTGAAAAGTCTATCGATTTTGCTTCTACTTCTCCC
TTAGGTGGTGGTCGCGAAGGTAGAACCAAGAGAAAGAATGCCAAGAAGTCTGCTTGA


>TTHERM_00434070(protein)
MIKYKGRKLVGINLKEKFWACGEESTKIIQREKYSIQIKVLSKVKQKIYKTKSIQIKMGK
TYINTSKTYSTPRRPYEKERLDNEMKLIGTFGLKNKREVWRVQMILAKFRKAARELLTLD
PKDPRRLFEGSALLRRMFKYGLLSEQERKLDYVLGLTIHKLMERRLQTRVFKLNLANSIH
HSRVLIRQRHIKVGKNLVNVPSFMVRTDSEKSIDFASTSPLGGGREGRTKRKNAKKSA


>TTHERM_00434070(gene)
ATGATAAAATATAAGGGGAGAAAATTAGTTGGAATAAATTTAAAAGAAAAATTTTGGGCG
TGTGGGGAGGAAAGTACAAAGATAATTTAAAGAGAAAAGTACAGCATCTAAATCAAAGTA
TTATCTAAAGTCAAATAAAAGATATATAAAACCAAAAGTATATAAATAAAAATGGGTAAA
ACCTACATCAACAGTAAATAATTTTTTTAATAATTGATCTCCATATTAATTGCTTTATTC
TCTTATCACAACAGCTTCCAAGACCTACTCTACCCCCAGAAGACCTTATGAAAAGGAAAG
ACTCGATAATGAGTACAATATTCATTTAATTATCCACTCTGACTTCATCCAATCCATTAA
TCTATCTATCAAATTATTATTTACTCATTCTTATTTTATCAACACAAATTTCACAAAACC
CTTAATTTAACATCCCAATCCATTATCGAAATTTGATTTATTAGCACAATTTCCTATATC
CATGGGACCAAAGCAAATTATTTGTTGAATTTAATGAGAAAGTAGTAGCTTCTCTAAAAA
TTATGAACCATTCTTACTGTAGTTTTAGCATTATGATATTTCTCGCAAGTAATTGATTAG
AAAATGTGAATCAATAGAAAAATAAATAAATAGCCTCAAGTTAAAAAACGAAGTAGATTA
ATTAGTAAATAAATGGCAGCTTAAGGAAGTAATTAATTATATATCCTTAATTATAAGCCA
TCAATCAATCAGAAAAAAAAAGAAGAAACAAACCATAAACCATATGAAAATAGTAAGGCA
TTAATTCGCTAACTAATCAAGCTATATCTAGGTAAAACCAAATTAGAAAGCAGGATGGAT
GCAAATAATATCCTATCAATAGAGAGAAGCAGTAAAAAAATTTGTTTAAAATCAATTCTT
AAAAAAATAGAGTGATTATGTATAAAATATCTTAAATAAGCAAACCAAAACAATATAAAA
ACCAAAGCATTAGTATTAAAACAATTAAGATGCTAAAGATTAATTAAAAACCAAAGGTTT
ATTTAGGATATTTTATTGATATATAGCAGAAAAAATGATTATGATTGATTGATTGATCAT
TTAATCAATTTGGTCAAAGGATCAATCAATCTCACTCTATTGATCTGTCAAAAAAAGAAT
TGGCTATCTATCAAGCCAAAGAGACGCAATAAAAGAATTAAAAAGAGTTTGTATGAAATA
TTAAAATATATTCATCATAAACGAACAACTAAAATTATTAAAACAAACAAATTTTTAATT
AAGCTCTCTTGATACAAACCAAATTCAAAATAAATGTGTACTTTTTGATAAATTTTCTAA
CTAAGTTCCTACTGCTTTTTAAAATTCCTGATCACTTTCTTTTCAAATTCATAGTTATTA
ATAATTAGATGATATAAATTCTTTGTTTGATTAATATATCAGTTAATATCCTACCTATTT
CGCTAAACACCTGTCAACTACTAATTAGCTCATATGATTCTTTACTTGCTTACAATAGCT
TGTCCTAAACTTGTTAAGAAATAAATACCAATCCACAAATAATACTAAAATGATTAATGA
TTTTTGTTGATAAAATAAGCATTTATAAATAATGAATGATAAATAGAAAGAAAAAAACCC
ATTTTTATAAATTAAATTTTAATTTTAATATTTTTTTTATTTAGAATGAAGCTTATCGGT
ACTTTCGGTTTAAAGAACAAGAGAGAAGTCTGGAGAGTTTAAATGATCTTGGCTAAGTTC
AGAAAGGCTGCTAGAGAATTGCTCACCTTAGACCCCAAGGACCCCAGAAGATTATTCGAA
GGTTCCGCCCTTTTAAGAAGAATGTTCAAATACGGTCTCCTCAGTGAATAAGAAAGAAAG
TTGGATTACGTCTTGGGTTTGACCATTCACAAGCTCATGGAAAGAAGACTCCAAACCAGA
GTTTTCAAGTTAAATTTGGCTAACTCTATCCACCATTCCAGAGTCCTTATTAGACAAAGA
CACATCAAGTAATTAACTAATTACCATTATTTGTTAAATATGTTAATTAATTTATTTATT
TAATTTATTAATAGGGTTGGTAAGAACTTAGTCAATGTTCCTTCCTTCATGGTTAGAACT
GACTCTGAAAAGTCTATCGATTTTGCTTCTACTTCTCCCTTAGGTGGTGGTCGCGAAGGT
AGAACCAAGAGAAAGAATGCCAAGAAGTCTGCTTGA