Identifiers and Description

Gene Model Identifier

TTHERM_00471090

Standard Name

RPS7 (Ribosomal Protein of the Small subunit 7)

Aliases

PreTt22523 | 56.m00227 | 3686.m00070

Description

Homolog of yeast RPS7, human RPS7;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00471090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11332.12.9998177333176706e-12430S ribosomal protein S7e (198
aa)
DictyBaseDDB_G02890259.995528898049344e-31rps7 on chromosome: 5 position
2252902 to 2253483
WormBaseWBGene000044769.002954397174899e-30locus:rps-7 40S ribosomal pr
otein S7 status:Confirmed
UniProt:Q23312 protein_id:CA
B00058.1
SGDYOR096W1.9993007828132465e-27RPS7A Protein component of the
small (40S) ribosomal subunit
, nearly identical to Rps7Bp;
interacts with Kti11p; deletio
n causes hypersensitivity to z
ymocin; has similarity to rat
S7 and Xenopus S8 ribosomal pr
oteins
OxytrichaContig980.0.g215.999207186122604e-25Ribosomal protein S7e
Stentor CoeruleusSteCoe_370182.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00471090(coding)
ATGGCTTTAGCTAAATTCCACAAGAAGCAATCCTTAACTAAGATCGAAGAATAGGTCGGT
TCCGCTTTGGTTGAACTCCAAAACACCCACCCTGATTTGAAGACCTCCCTCGAATCTATC
ATCCTCACCCAAGTTAAGGAATTCTAAATTAACAAGACCAACAAGAAGGCTAAGTCTGCT
GTCTTAATTTACGTCCACTTCCAATCTTACAGAGTTCTTTTGTCTGCTGCTAGAAAGCTC
ATCATCGAACTCGAAAAGAAGCTCAAGCAAATCGTCTTCTTCACCGCTTAAAGAAAGATC
GAATCTAAGTGGGTTAAGGAACACAAGTCTCAACAAAGACCCAGATCCAGATGTTTGACC
TACGTCTACGATGCTCTCCTTGACGACTTACTCCTTCCTTCCACCCTCATTGGTAAGAGA
ATCAGAGCTAGACTCGATGGTACTTCTTTCTACAGAATCCAATTAGACCAAAACGATAGA
GATTTCTTGGAAGAAAAGTTAGATGCTATCACTCACATCTATAAGACTGTCACCACCAGA
GAAGTCACCTTCGAATTCAAGGAAGACAAAACTTTCCATACCTTCAAGAAATGA


>TTHERM_00471090(protein)
MALAKFHKKQSLTKIEEQVGSALVELQNTHPDLKTSLESIILTQVKEFQINKTNKKAKSA
VLIYVHFQSYRVLLSAARKLIIELEKKLKQIVFFTAQRKIESKWVKEHKSQQRPRSRCLT
YVYDALLDDLLLPSTLIGKRIRARLDGTSFYRIQLDQNDRDFLEEKLDAITHIYKTVTTR
EVTFEFKEDKTFHTFKK


>TTHERM_00471090(gene)
ATGGCTTTAGCTAAATTCCACAAGAAGCAAGTAATTAAATTGATTTAAGAAAAGAAGAAG
CATAGCTTCGCAAACATTTCACAGAGTTAAATGCAAATTATTTATATTTATAAAATAGTC
CTTAACTAAGATCGAAGAATAGGTCGGTTCCGCTTTGGTTGAACTCCAAAACACCCACCC
TGATTTGAAGACCTCCCTCGAATCTATCATCCTCACCCAAGTTAAGGAATTCTAAATTAA
CAAGACCAACAAGAAGGCTAAGTCTGCTGTCTTAATTTACGTCCACTTCCAATCTTACAG
AGTTCTTTTGTCTGCTGCTAGAAAGCTCATCATCGAACTCGAAAAGAAGCTCAAGCAAAT
CGTCTTCTTCACCGCTTAAAGAAAGATCGAATCTAAGTGGGTTAAGGAACACAAGTCTCA
ACAAAGACCCAGATCCAGATGTTTGACCTACGTCTACGATGCTCTCCTTGACGACTTACT
CCTTCCTTCCACCCTCATTGGTAAGAGAATCAGAGCTAGACTCGATGGTACTTCTTTCTA
CAGAATGTAATTTATTTAGCCCTTTTTTCAAAATTTTTCCTACTTATTAGATACTTTCAT
CTCTATAAGCTCTCCTTTTTTCGAATTTTATCTCTTCAAATATAGCCTTTAAAAATAATA
ATAACCATCAAAAATGATACTGAGTGAAGTAAAAAAATTTAGCAGACCGCCTATGATTTA
TCAGTTATGCGAAAAATAACATTTAATTAGTTTTAGTTAGCATTGATAGCTTCTACGAAG
TGGAATTAAATCATCAAAAAATTAAATTCCTTCATTTTTCAACTAAATTTATGACAAAAT
AATAAGATCAAAAATAAGAAAATTGGCTTAAATGTGTCCCCTTTTTAAGTAGTAAAATTA
AATTAATAAGGAAAGCAGTTATGTATTGAATTAAAAGGGAATCACGATTCAGAATTTTGG
TTAAAAAGCTAAGGCTTATTCAGCAAGTTAAATAGAATATTTATAAAATAGTTCAATAAT
AGAGTTTATTTCCGCATATCATTGATTGATTAGCTGCAAAAAAACAAAATAGAATAGTTG
AAAGTTAATTTTGATCTGTTTCAGAAAAGACTAATTAACTTAAAAGCTATAAATTTAAAA
GGTCCAAAAGTGAAAAGTTGTAAATGAACGAACAATAAATATGTTGAAAGTCACACCTAT
CTATGTACTTTTTTCCTACTTATAGAACTCATTCAATGATCAGTCAATCAAAAAATGAAA
ATTCATATGATTTTACAATTAAAATGTTAAATTGAGTATACTTGACAGGTAGAATCATAT
GAATTATGTACTTCCTTCATAATTAGAATAACGATTGCTTGATGAATGATGCTACTAACT
AACTAAAATAAATTATTTTCTATGTATTTGATCTTTGAAACCTTCTGGAGTGTAAAGCTA
AATACTTAAGAATAAATAAAAACAATTTTAAGAAGTAAGCCTAACCTTCTTTTTAATAAG
TGCTTTGCTTGTTTAATTATCTAAAGATTAACTAAATCATTTAACTAAATTAATTAAACA
ACTCTTTTCAGTAATCAGATAAAAATGATTTTTGCTAAATACTTCTAATAAACATAAAAT
TTAAATAAGAAAACTGAATCTGAAAAATATTAACAATAATTAATAACAATTTTTATTTAT
AATGGCTGATGGAGCTTAAAATGATTGTAAAAACAAAAATTAAATGAGAAAAAGAGAGAT
AAAAATGAGATGAATTATCTATATTTATTTATAAAATCATTTTATTCTAGATATTAAAAT
TAATTTCAATAAAAAAAATAGCCAATTAGACCAAAACGATAGAGATTTCTTGGAAGAAAA
GTTAGATGCTATCACTCACATCTATAAGACTGTCACCACCAGAGAAGTCACCTTCGAATT
CAAGGAAGACAAAACTTTCCATACCTTCAAGAAATGA