Identifiers and Description

Gene Model Identifier

TTHERM_00149798

Standard Name

RPS6 (Ribosomal Protein of the Small subunit 6)

Aliases

3700.m01683

Description

Homolog of yeast RPS6, human RPS6;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00149798

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05038.19.996149531968772e-161hypothetical protein (298 aa)
OxytrichaContig14465.0.g802.000341663036036e-86Ribosomal protein S6e
SGDYPL090C9.999776257620412e-83RPS6A Protein component of the
small (40S) ribosomal subunit
; identical to Rps6Bp and has
similarity to rat S6 ribosomal
protein
WormBaseWBGene000044753.9983507938127826e-75locus:rps-6 40S ribosomal pr
otein S6 status:Confirmed
UniProt:Q9NEN6 protein_id:CA
B81996.1
DictyBaseDDB_G02808239.000650761534676e-74rps6 on chromosome: 3 position
1442353 to 1443385
Stentor CoeruleusSteCoe_323776.639677199580735e-36

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00149798(protein)
MKFNISYPLTGAQKCIEIDDDKKCNIFMDKKMGQEVEGDTLGDEFKGYVFKIAGGNDKDG
FPMKQGVMVRGRVRLLLSEGHSCFTSRRSGFRKRKSVRGCIVGPDMRVLALQIVKKGVAE
IDGLTTVTLPRKLGPKRANNIKKLFGLKKEDDPILIKKSVIRRTFKTAKGKDRTKCPKIQ
RLITPERILRKKVYKAEKTQRYVKTNAAKEEYEKFLSEWKKQRAAKAHAASAPVVEAPKK
VEAPKKVDPKAAKTTPAATKATPAATKVAPKTQAAKTTTPAPAVKDAKKTTKK


>TTHERM_00149798(coding)
ATGAAATTCAACATTAGTTATCCTCTCACTGGTGCTCAAAAGTGCATCGAAATCGACGAC
GACAAGAAATGCAACATCTTCATGGACAAGAAGATGGGTCAAGAAGTCGAAGGTGATACC
TTGGGTGACGAATTCAAGGGATACGTCTTCAAGATTGCTGGTGGTAACGATAAGGACGGT
TTCCCCATGAAGCAAGGTGTCATGGTCAGAGGTAGAGTTAGACTCCTTCTCAGTGAAGGT
CACTCTTGCTTCACCAGCAGAAGATCTGGTTTCAGAAAGAGAAAGTCTGTCAGAGGTTGC
ATCGTTGGTCCCGATATGAGAGTTCTTGCTCTTCAAATCGTCAAGAAGGGTGTTGCTGAA
ATCGACGGTCTTACCACTGTTACTTTACCCAGAAAGCTTGGTCCCAAGAGAGCTAACAAC
ATCAAGAAGTTGTTCGGCTTGAAGAAGGAAGATGATCCCATTCTCATCAAGAAGTCCGTC
ATCAGAAGAACCTTCAAGACTGCCAAGGGTAAGGATAGAACAAAATGCCCCAAGATCCAA
AGACTTATTACCCCTGAAAGAATCCTCAGAAAGAAGGTTTACAAGGCTGAAAAGACCCAA
AGATACGTTAAGACTAACGCTGCTAAGGAAGAATACGAAAAGTTCTTAAGTGAATGGAAG
AAGCAAAGAGCTGCTAAGGCTCACGCTGCCAGCGCTCCCGTTGTTGAAGCTCCCAAGAAG
GTTGAAGCCCCTAAGAAGGTTGATCCTAAGGCTGCTAAGACCACCCCTGCTGCTACCAAG
GCCACCCCTGCTGCTACCAAGGTTGCCCCTAAGACCCAAGCTGCTAAGACTACTACCCCT
GCTCCCGCTGTTAAGGATGCTAAAAAAACTACCAAAAAGTGA


>TTHERM_00149798(gene)
ATGAAAGTAATTTTTTTTCTTTGTTTTGAAGCAGAATTTATAATATAATTCTAATAATAG
AATAACAAAAATATATTATAATCCAAAATCCTATCTGTTTTAACATATTCTATTTTATTA
AAAAATAGTTCAACATTAGTTATCCTCTCACTGGTGCTCAAAAGTGCATCGAAATCGACG
ACGACAAGAAATGGTAAAGATATTATCATAATTAATCAATTGTTTGTTTTCATCATCATC
ATTTATCTCACATTCCTTCAGCAATATTTTTTGCAAGAAACACACTAAAAAAAGGAAAAT
GGTTTTAGCGAATATTTAGAATTCTAAAAGAATTAAAGTGGTAAAAAATGATTTTGAGGA
AAGTCTGTATCAGTAGAATTTATTTTTAATAGGTTTTCTCAGCATAATTTTAGCTAACAA
TTTTTAGAGGGAAGAATATTAATTTTGAGCAGTATTTGAATTTTGATGCCAAATAGGAAG
CTGAGATTTTGAATAACGCTAAATTCTATCATTTTCCTACCAACAAAGATATTGAAATAT
AATGATGATGATGAAGCTATTTTGATTTCATTCGGATATAAATTATATTCTGAAACACTC
TAATTATATTTTAAGAATAACTAACAATTTTTCTTTTATATATAGCAACATCTTCATGGA
CAAGAAGATGGGTCAAGAAGTCGAAGGTGATACCTTGGGTGACGAATTCAAGGGATACGT
CTTCAAGATTGCTGGTGGTAACGATAAGGACGGTTTCCCCATGAAGCAAGGTGTCATGGT
CAGAGGTAGAGTTAGACTCCTTCTCAGTGAAGGTCACTCTTGCTTCACCAGCAGAAGATC
TGGTTTCAGAAAGAGAAAGTCTGTCAGAGGTTGCATCGTTGGTCCCGATATGAGAGTTCT
TGCTCTTCAAATCGTCAAGAAGGGTGTTGCTGAAATCGACGGTAAATAAAATTATAAAAT
ATAGATGTTTTATTGCTCTTGGATATATTTATTTAATTGATTGATGTAATTGTGAATGTC
TTTTCTATGATAGTCAATTTAAGCATTTTCTCAGTTTCTTTAGTAGATTTAGTTCTTTTT
GAAGAAAACTATGATTTTAATTGAAATATTAGAGAAATAGTAGATAGGTAGGTAGGATAA
TACTTTTTAAAGTAAAAACGAATAGATAATATATTATTATTAACTCAAAATAAGTCAAAA
GTTCAAATATCTATTTTTTTTGTCAATTCTTTGCTTGAAAATGAATAGTAAGATATCTAT
CTAACTATCTATCCACTATAGGTTTCAAATATTAATTAGTATCAAAACTAAGGACAAAAT
TAGCTTAGAGTGAAAGCAATAATCTAAATAAATAAATCAATCTATTAACCAATTAATAGC
TCTCAAAATTAAAGATAGCAAAAGTATTTAGTTTCCCTCAAAGTTTAGAAATCATTCATT
TGTATAATTAACCAATCAATATGATCAATAAATTAATTAATTTTCTGTTTCAAATACTTC
TGTTTTATAAGAGCTAATTAATAAATAAATGCATTTATTCTATTTACAGCTAGATAAATA
GACAGCTGGAGGTATCTTAAATCAAACAATCAACATAATTACAATAATATTCTAAATGCT
TATTTTAAGTAAATTTAGATATTTAATGTAAATTAATTAATGTTTGCACTAAAATATACA
AAAGATTAAATGAATTAGCTTAAATATGTATAGCTTGCTATTAATTATACTGGATAAGTA
ACTAAAACTTAAAAATAATTTAGTGATCTATACTATGATTTGATTAAATTGCACAGTAAG
ATGCTAACTTACTCAAAAATTATCATTAAAGAGACTCATTCAGTCACATACTCACAATTA
AATTTAATATCCAAGACAATTAATTCATTGATTTTTATAAATTTCTTTCTCTCTATAAAA
AAATTAAAATTAACTTATTTTATCTAATTTAGGTCTTACCACTGTTACTTTACCCAGAAA
GCTTGGTCCCAAGAGAGCTAACAACATCAAGAAGTTGTTCGGCTTGAAGAAGGAAGATGA
TCCCATTCTCATCAAGAAGTCCGTCATCAGAAGAACCTTCAAGACTGCCAAGGGTAAGGA
TAGAACAAAATGCCCCAAGATCCAAAGACTTATTACCCCTGAAAGAATCCTCAGAAAGAA
GGTTTACAAGGTAAAACTTACAAACATCTATCTAGTTAATTTAAATTAACTTAATATTCT
TAATAATAGGCTGAAAAGACCCAAAGATACGTTAAGACTAACGCTGCTAAGGAAGAATAC
GAAAAGTTCTTAAGTGAATGGAAGAAGCAAAGAGCTGCTAAGGCTCACGCTGCCAGCGCT
CCCGTTGTTGAAGCTCCCAAGAAGGTTGAAGCCCCTAAGAAGGTTGATCCTAAGGCTGCT
AAGACCACCCCTGCTGCTACCAAGGCCACCCCTGCTGCTACCAAGGTTGCCCCTAAGACC
CAAGCTGCTAAGACTACTACCCCTGCTCCCGCTGTTAAGGATGCTAAAAAAACTACCAAA
AAGTGA