Identifiers and Description

Gene Model Identifier

TTHERM_01386050

Standard Name

RPS5 (Ribosomal Protein of the Small subunit 5)

Aliases

PreTt28119 | 358.m00012

Description

Homolog of yeast RPS5, human RPS5, bacterial RPS7

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01386050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20493.11.999872053281847e-142ribosomal protein S7 containin
g protein (201 aa)
OxytrichaContig1487.0.g851.0002223712504345e-79Ribosomal protein S7p/S5e
WormBaseWBGene000044746.998089991989877e-78locus:rps-5 40S ribosomal pr
otein S5 status:Confirmed
UniProt:P49041 protein_id:CA
A92971.1
DictyBaseDDB_G02860753.9983507938127826e-75rps5 on chromosome: 4 position
4031568 to 4032398
SGDYJR123W7.997481627602355e-72RPS5 Protein component of the
small (40S) ribosomal subunit,
the least basic of the non-ac
idic ribosomal proteins; phosp
horylated in vivo; essential f
or viability; has similarity t
o E. coli S7 and rat S5 riboso
mal proteins
Stentor CoeruleusSteCoe_184654.4737793061811207e-38

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_01386050(coding)
ATGTCTGTAGAAAAAGGATTTGCCACCCAACCCAAACTTTTCGGTAAGTGGAACTACGAT
GAAGTCAAGATCTAAGATCCTTGCTTCTAAAACTACATTGCTTGTACCACTACCAAGTCC
CAAGTTTTCGTTCCCCACACTGCTGGCAGATATCAAGTCAAGAAGTTCAGAAAGACTCAA
TGCCCCATTGTTGAAAGATTAATTGGTACTCTTATGTTCCACGGTAGAAACGCTGGTAAG
AAGGCTCTCTGCATCAAGGTCGTCAAGAACGCTTTTGAAATCATCCACTTGGTTACCGGA
AGAAACCCCTTGGAAGTTTTCGTTGGTGCCGTCCAAAATGCTGGTCCCAGAGAAGACTCC
ACCAGAATCGGTACTGCTGGTGTCGTCAGAAAATAAGCTGTCGACGTTGCTCCCATGAGA
AGAGTTAACCTTGCTATTTATTTCATCATTAAGGGTTGCAGAGAATCTGCTTTCAAATCA
ATGAGATCTATCGCTGAAACCTTAGCTGATGAAATCATCAATGCTGAAAAGAACAACACC
CAATCTTCCTGGGCTATTAGAAAGAAAGACGAAATCGAAAAGGTCGCTAAGGGTAACAGA
TGA


>TTHERM_01386050(protein)
MSVEKGFATQPKLFGKWNYDEVKIQDPCFQNYIACTTTKSQVFVPHTAGRYQVKKFRKTQ
CPIVERLIGTLMFHGRNAGKKALCIKVVKNAFEIIHLVTGRNPLEVFVGAVQNAGPREDS
TRIGTAGVVRKQAVDVAPMRRVNLAIYFIIKGCRESAFKSMRSIAETLADEIINAEKNNT
QSSWAIRKKDEIEKVAKGNR


>TTHERM_01386050(gene)
ATGTCTGTAGAAAAAGGATTTGCCACCCAACCCAAACTTTTCGGTAAGTGGAACTACGAT
GAAGTCAAGATCTAAGATCCTTGCTTCTAAAACTACATTGCTTGTACCACTACCAAGTCC
CAAGTTTTCGTTCCCCACACTGCTGGCAGATATCAAGTCAAGAAGTTCAGAAAGACTCAA
TGCCCCATTGTTGAAAGATTAATTGGTACTCTTATGTTCCACGGTAGAAACGCTGGTAAG
AAGGCTCTCTGCATCAAGGTCGTCAAGAACGCTTTTGAAATCATCCACTTGGTTACCGGA
AGAAACCCCTTGGAAGTTTTCGTTGGTGCCGTCCAAAATGCTGGTCCCAGAGAAGACTCC
ACCAGAATCGGTACTGCTGGTGTCGTCAGAAAATAAGCTGTCGACGTTGCTCCCATGAGA
AGAGTTAACCTTGCTATTTATTTCATCATTAAGGGTTGCAGAGAATCTGCTTTCAAATCA
ATGAGATCTATCGCTGAAACCTTAGCTGATGAAATCATCAATGCTGAAAAGAACAACACC
CAATCTTCCTGGGCTATTAGAAAGAAAGACGAAATCGAAAAGGTCGCTAAGGGTAACAGA
TGA