Identifiers and Description

Gene Model Identifier

TTHERM_01386050

Standard Name

RPS5 (Ribosomal Protein of the Small subunit 5)

Aliases

PreTt28119 | 358.m00012

Description

RPS5 40S ribosomal protein S5; Homolog of yeast RPS5- human RPS5- bacterial RPS7

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01386050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20493.11.999872053281847e-142ribosomal protein S7 containin
g protein (201 aa)
OxytrichaContig1487.0.g851.0002223712504345e-79Ribosomal protein S7p/S5e
WormBaseWBGene000044746.998089991989877e-78locus:rps-5 40S ribosomal pr
otein S5 status:Confirmed
UniProt:P49041 protein_id:CA
A92971.1
DictyBaseDDB_G02860753.9983507938127826e-75rps5 on chromosome: 4 position
4031568 to 4032398
SGDYJR123W7.997481627602355e-72RPS5 Protein component of the
small (40S) ribosomal subunit,
the least basic of the non-ac
idic ribosomal proteins; phosp
horylated in vivo; essential f
or viability; has similarity t
o E. coli S7 and rat S5 riboso
mal proteins
Stentor CoeruleusSteCoe_184654.4737793061811207e-38

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_01386050(coding)
ATGTCTGTAGAAAAAGGATTTGCCACCCAACCCAAACTTTTCGGTAAGTGGAACTACGAT
GAAGTCAAGATCTAAGATCCTTGCTTCTAAAACTACATTGCTTGTACCACTACCAAGTCC
CAAGTTTTCGTTCCCCACACTGCTGGCAGATATCAAGTCAAGAAGTTCAGAAAGACTCAA
TGCCCCATTGTTGAAAGATTAATTGGTACTCTTATGTTCCACGGTAGAAACGCTGGTAAG
AAGGCTCTCTGCATCAAGGTCGTCAAGAACGCTTTTGAAATCATCCACTTGGTTACCGGA
AGAAACCCCTTGGAAGTTTTCGTTGGTGCCGTCCAAAATGCTGGTCCCAGAGAAGACTCC
ACCAGAATCGGTACTGCTGGTGTCGTCAGAAAATAAGCTGTCGACGTTGCTCCCATGAGA
AGAGTTAACCTTGCTATTTATTTCATCATTAAGGGTTGCAGAGAATCTGCTTTCAAATCA
ATGAGATCTATCGCTGAAACCTTAGCTGATGAAATCATCAATGCTGAAAAGAACAACACC
CAATCTTCCTGGGCTATTAGAAAGAAAGACGAAATCGAAAAGGTCGCTAAGGGTAACAGA
TGA


>TTHERM_01386050(protein)
MSVEKGFATQPKLFGKWNYDEVKIQDPCFQNYIACTTTKSQVFVPHTAGRYQVKKFRKTQ
CPIVERLIGTLMFHGRNAGKKALCIKVVKNAFEIIHLVTGRNPLEVFVGAVQNAGPREDS
TRIGTAGVVRKQAVDVAPMRRVNLAIYFIIKGCRESAFKSMRSIAETLADEIINAEKNNT
QSSWAIRKKDEIEKVAKGNR


>TTHERM_01386050(gene)
ATGTCTGTAGAAAAAGGATTTGCCACCCAACCCAAACTTTTCGGTAAGTGGAACTACGAT
GAAGTCAAGATCTAAGATCCTTGCTTCTAAAACTACATTGCTTGTACCACTACCAAGTCC
CAAGTTTTCGTTCCCCACACTGCTGGCAGATATCAAGTCAAGAAGTTCAGAAAGACTCAA
TGCCCCATTGTTGAAAGATTAATTGGTACTCTTATGTTCCACGGTAGAAACGCTGGTAAG
AAGGCTCTCTGCATCAAGGTCGTCAAGAACGCTTTTGAAATCATCCACTTGGTTACCGGA
AGAAACCCCTTGGAAGTTTTCGTTGGTGCCGTCCAAAATGCTGGTCCCAGAGAAGACTCC
ACCAGAATCGGTACTGCTGGTGTCGTCAGAAAATAAGCTGTCGACGTTGCTCCCATGAGA
AGAGTTAACCTTGCTATTTATTTCATCATTAAGGGTTGCAGAGAATCTGCTTTCAAATCA
ATGAGATCTATCGCTGAAACCTTAGCTGATGAAATCATCAATGCTGAAAAGAACAACACC
CAATCTTCCTGGGCTATTAGAAAGAAAGACGAAATCGAAAAGGTCGCTAAGGGTAACAGA
TGA