Identifiers and Description

Gene Model Identifier

TTHERM_00149300

Standard Name

RPS4 (Ribosomal Protein of the Small subunit 4)

Aliases

PreTt20689 | 12.m00363 | 3700.m00085

Description

Homolog of yeast RPS4, human RPS4;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00149300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04990.19.997093137033517e-262ribosomal family S4e containin
g protein (261 aa)
OxytrichaContig21054.0.g589.99679536751975e-103Ribosomal family S4e
SGDYJR145C2.000724368835138e-100RPS4A Protein component of the
small (40S) ribosomal subunit
; mutation affects 20S pre-rRN
A processing; identical to Rps
4Bp and has similarity to rat
S4 ribosomal protein
DictyBaseDDB_G02728253.9985196551577655e-99rps4 on chromosome: 2 position
2019070 to 2020303
WormBaseWBGene000044732.0001925730668994e-91locus:rps-4 40S ribosomal pr
otein S4 status:Confirmed
UniProt:Q9N3X2 protein_id:CC
D74049.1
Stentor CoeruleusSteCoe_302622.2856936767186716e-49

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00149300(coding)
ATGAAAGGCAAGAAAAGAAAAATACGAAAGAAATTTAGTTAAAATATCAAAATAATTAAA
GGAGTTTAAAATTAGTGTATAGAAGAGGGATGTATGAAATTAGGCCTAATAAAGAAGAAG
AAAAGAATTTTAGAGTGGGGATAAAAGTTAAATTAATAAAGGAAAGATATTAAAAATTAA
TAAACACCAAATAAAAAGAAGAAAACAAAAATGGCTCGTGGTCCTAAAAAACACTTAAAG
AGAATCAACGCTCCCAAGTCTTGGATGCTCAACAAGTTGGGTGGTATCTGGGCTACCAGA
CCTTCCCAAGGTCCTCACAAGCTTAGAGAATCTCTCCCTCTCTCTGTCTTACTCAAGGAA
AGACTTAACTACGCTTTGAACGGTAGAGATGTCACCCTTATCCTCAACGATAAGGAATAA
AACGTCTTTGTTGACGGTAAGGTCAGAAGAGACAAGGGTTACCCCACTGGTCTTATGGAT
GTCGTCAGAATTGAAAAGACTGACTAATCTTTCAGAATCCTCTACGACACCAAGGGTAGA
TTCGTCCTCAAGTCCCTCAGCAAGGAAGAAGCTAAGTACAAGCTCTTGAAGGTCACTGCT
AAGGCTATTGGTCCCAACCAAATCCCTTACATCGTTACCCACGACTCTAGAACCATCAGA
TTCCCTAACCCCGAAATCAAGATCGGTGATACCCTTAAATACGATCTCGTTAACAACAAG
ATTGAAAACTTCGCTCACTTAGAATCCGGTAATGTTTGCTACATTCAATAAGGTAACAAC
ATCGGTAGAGTCGGTATCATCTAACACATCGAAAAGCATCAAGGTTCCTTCGATATTTGC
CACGTTAAGGATGCTAAGGGTAACGCTTTCGCTACCAGATTAGGTAACATCTTCGTCTTA
GGTCAAGGTAAGAAGTCCTGGATCGAACTTCCTTCCGGTGATGGTGTTAGAGAAACTATT
CTTGAAGAAAGAAAGAGAAAGTTCTCTTACTGA


>TTHERM_00149300(protein)
MKGKKRKIRKKFSQNIKIIKGVQNQCIEEGCMKLGLIKKKKRILEWGQKLNQQRKDIKNQ
QTPNKKKKTKMARGPKKHLKRINAPKSWMLNKLGGIWATRPSQGPHKLRESLPLSVLLKE
RLNYALNGRDVTLILNDKEQNVFVDGKVRRDKGYPTGLMDVVRIEKTDQSFRILYDTKGR
FVLKSLSKEEAKYKLLKVTAKAIGPNQIPYIVTHDSRTIRFPNPEIKIGDTLKYDLVNNK
IENFAHLESGNVCYIQQGNNIGRVGIIQHIEKHQGSFDICHVKDAKGNAFATRLGNIFVL
GQGKKSWIELPSGDGVRETILEERKRKFSY


>TTHERM_00149300(gene)
ATGAAAGGCAAGAAAAGAAAAATACGAAAGAAATTTAGTTAAAATATCAAAATAATTAAA
GGAGTTTAAAATTAGTGTATAGAAGAGGGATGTATGAAATTAGGCCTAATAAAGAAGAAG
AAAAGAATTTTAGAGTGGGGATAAAAGTTAAATTAATAAAGGAAAGATATTAAAAATTAA
TAAACACCAAATAAAAAGAAGAAAACAAAAATGGTAATCCTTTGAATAATTTACAACTTA
AAACAGCATAAGATATTGCATATATTTTATGCTTAATATACAAATTAATTTCTATTACAG
TCCCTCATTTTTTTTCTTTTGAAATTTATAAAAAGGCTCGTGGTCCTAAAAAACACTTAA
AGAGAATCAACGCTCCCAAGTCTTGGATGCTCAACAAGTTGGGTGGTATCTGGGTAATTA
CATTTTTTGCATTTCGTCTTAGAAAAAATGACTTTATTACTACAATTCCTAAACTTAAAT
TTATTTATTTTAAAAAATAGGCTACCAGACCTTCCCAAGGTCCTCACAAGCTTAGAGAAT
CTCTCCCTCTCTCTGTCTTACTCAAGTAAGAATATAAAAAATAAACATAATTTTTGATTC
TTCTCGTTTTTGTAATCGTCAAATACTTAGAGCCCAAGGAAAAATTTAAAGCAAAATGAA
TAAAGTTACAACTTAAAATTGATTTATATAGATTTATTGCTTTTAAGATTTAATAGAGGT
AGAATTAGGAGCAATTGTTAATAAATTATTTTAGCCTTATTAGCCTAGATTAGCTTAATT
AGCTAGCAGCAATTTCATTAAATTGTTTGATGTAAAATCAATTAAATTGATCTTAAATTT
GAATTCAATGTACTTAAATTGATGGCAATTGCTCTGCTTGCTTGGCCTCTTAGAGTCTCT
TAAAATTAGAGAGTAAAAGAATGAGGCTATATCATAATAGTATCATCATAAGTTGTGAAG
ATTTGTTAATGTTAGGAATGATCAAATTTAGTAAATAAGTAAGTGAGTGATTTAGTGAGA
GAGTAATTAAAAAAAAGAAAATATTCATAAGGTGTAGCAAAGCATATTTATTAAGCTAAT
AAAAAGAAAAATAGGAAAATAATAATTTGAAAAAATGGATAAACAATTGCAAAAGCTAAT
AAATTTTCTAAACTTTCATTAGAAAACGTTAAAAAAACTAGCAATCTCTCATTAGAATTA
TAACTAGATACTATTTCTAATAATTGCTTATTTCTACCATCTCATGTCTGCCTTAACAAT
AAATGCAAACTTACACATACATACATATCTAAAACTTAATAAATAAATAAATCAATGAAT
TATTAATTTATTAATTAATAAATTAATTGAGGCTAAAGATATTTATCATTTTAATAAATT
TAGATTCCTTGAATGCTTAAATATTTTGACTATTACAACAAGCAAGCAAATGAAGAATTT
ATTTTATTCAAATAATAAAAATGGAAATTAATTATTTAATTTTTTTTGATGTAACTACTT
AGGGAAAGACTTAACTACGCTTTGAACGGTAGAGATGTCACCCTTATCCTCAACGATAAG
GAATAAAACGTCTTTGTTGACGGTAAGGTCAGAAGAGACAAGGGTTACCCCACTGGTCTT
ATGGATGTCGTCAGAATTGAAAAGACTGACTAATCTTTCAGAATCCTCTACGACACCAAG
GGTAGATTCGTCCTCAAGTCCCTCAGCAAGGAAGAAGCTAAGGTAAAAATAACAATCTAA
AAAAAGCTAAATTTATTGCTTGTTATATACATGAAATTATGTATGCACTCATCCCCAACT
TATAATTTAGAAATAAATCTTAAAACAAAAACAGATTAGCAAAATAAATAACTGAATTTA
TGAATAAATAAATCTCTCTAATTAGCATTTCAAGCAATTTAGCTATTTTCAACATTTATT
TTTGTAATCCAAATGTGCTAAATTCTATTTTTATATTCAATAGTACAAGCTCTTGAAGGT
CACTGCTAAGGCTATTGGTCCCAACCAAATCCCTTACATCGTTACCCACGACTCTAGAAC
CATCAGATTCCCTAACCCCGAAATCAAGATCGGTGATACCCTTAAATACGATCTCGTTAA
CAACAAGATTGAAAACTTCGCTCACTTAGAATCCGGTAATGTTTGCTACATTCAATAAGG
TAACAACATCGGTAGAGTCGGTATCATCTAACACATCGAAAAGCATCAAGGTTCCTTCGA
TATTTGCCACGTTAAGGATGCTAAGGGTAACGCTTTCGCTACCAGATTAGGTAACATCTT
CGTCTTAGGTCAAGGTAAGAAGTCCTGGATCGAACTTCCTTCCGGTGATGGTGTTAGAGA
AACTATTCTTGAAGAAAGAAAGAGAAAGTTCTCTTACTGA