Identifiers and Description

Gene Model Identifier

TTHERM_00686150

Standard Name

RPS31 (Ribosomal Protein of the Small subunit 31)

Aliases

PreTt18229 | 104.m00161 | 3732.m00074

Description

Homolog of yeast RPS31, human RPS27a; Ubiquitin-RPS31 fusion protein;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00240 ) Ubiquitin family
  • ( PF01599 ) Ribosomal protein S27a
  • ( PF08792 ) A2L zinc ribbon domain
  • ( PF07754 ) Domain of unknown function (DUF1610)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00686150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17402.12.0001925730668994e-91ribosomal protein S27a contain
ing protein (189 aa)
WormBaseWBGene000067256.002718307283067e-26locus:ubl-1 Ubiquitin-like p
rotein 1-40S ribosomal protein
S27a status:Confirmed Uni
Prot:P37165 protein_id:CCD72
254.1
DictyBaseDDB_G02767654.998394530072393e-19ubqC on chromosome: 2 position
7198772 to 7199606
OxytrichaContig11703.0.g44.0009493637353324e-18Ribosomal protein S27a
SGDYLR167W6.997351175151406e-18RPS31 Fusion protein that is c
leaved to yield a ribosomal pr
otein of the small (40S) subun
it and ubiquitin; ubiquitin ma
y facilitate assembly of the r
ibosomal protein into ribosome
s; interacts genetically with
translation factor eIF2B

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00686150(coding)
ATGTAGGTTTAGGTTAAAACCTTAGAAGGTGAGACCAAGATCTATACCTTAGAGCAAGGT
ACTAGCGTCTTGGACTTAAAAAGCTAAATTTCCTAGGATATGGGATTTGAAATCGACATG
ATGACTTTGGTTAACAACGGTTTCATCGCTCCCAACACCGAATTGGTTACTGACGATGTC
ACCTATTATCTTTCCCTTAAGTTATTGGGTGGTAAGAAGAAGAAGAAAAAAAAATCTTAC
ACCACCAAGAAGAAAACCAAACATAGACACGTCCATACCAAGTTAGGTGCTCTTGCTTTC
TACAAGCTTGAAAACAACGGTAAGGTCTCTTTGTAACAAAAGGGTTGTCCCAAGTGCGGT
CCTGGTATCTTCATGGCCAAGCATTACGATAGACATTACTGCGGTAAATGCCATCTTACC
TTGAAGATCGATGCTGAAACTGCTAAGAAGAACTTAGAAGAATTAAAGAAAAAGCAAGAT
GCTAAGAAATCTGGTGCTGCTGCTACCGATGCTGGTGCCGGTGGTGCAGGTAAGAAGGAC
GCTAAGAAGGGAAAGAAGGGTAAAAAATGA


>TTHERM_00686150(protein)
MQVQVKTLEGETKIYTLEQGTSVLDLKSQISQDMGFEIDMMTLVNNGFIAPNTELVTDDV
TYYLSLKLLGGKKKKKKKSYTTKKKTKHRHVHTKLGALAFYKLENNGKVSLQQKGCPKCG
PGIFMAKHYDRHYCGKCHLTLKIDAETAKKNLEELKKKQDAKKSGAAATDAGAGGAGKKD
AKKGKKGKK


>TTHERM_00686150(gene)
ATGTAGGTTTAGGTTAAAACCTTAGAAGGTGAGACCAAGATCTATACCTTAGAGCAAGGT
ACTAGCGTCTTGGACTTAAAAAGCTAAATTTCCTAGGATATGGGATTTGAAATCGACATG
ATGACTTTGGTTAACAACGGTTTCATCGCTCCCAACACCGAATTGGTTACTGACGATGTC
ACCTATTATCTTTCCCTTAAGTTATTGGGTGGTAAGAAGAAGAAGAAAAAAAAATCTTAC
ACCACCAAGAAGAAAACCAAACATAGACACGTCCATACCAAGTTAGGTGCTCTTGCTTTC
TACAAGCTTGAAAACAACGGTAAGGTCTCTTTGTAACAAAAGGGTTGTCCCAAGTGCGGT
CCTGGTATCTTCATGGCCAAGCATTACGATAGACATTACTGCGGTAAATGCCATCTTACC
TTGAAGATCGATGCTGAAACTGCTAAGAAGAACTTAGAAGAATTAAAGAAAAAGCAAGAT
GCTAAGAAATCTGGTGCTGCTGCTACCGATGCTGGTGCCGGTGGTGCAGGTAAGAAGGAC
GCTAAGAAGGGAAAGAAGGGTAAAAAATGA