Identifiers and Description

Gene Model Identifier

TTHERM_00526450

Standard Name

RPS30 (Ribosomal Protein of the Small subunit 30)

Aliases

PreTt06383 | 66.m00182 | 3722.m00040

Description

Homolog of yeast RPS30, human RPS30;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00526450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13396.11.000159011384939e-43ribosomal protein S30 containi
ng protein (81 aa)
OxytrichaContig16083.0.g1000.00000000000040012475857291343Ribosomal protein S30
SGDYOR182C0.00000000019994075865167896RPS30B Protein component of th
e small (40S) ribosomal subuni
t; nearly identical to Rps30Ap
and has similarity to rat S30
ribosomal protein
WormBaseWBGene000044990.0000000010002658722841845locus:rps-30 status:Confirme
d UniProt:Q18231 protein_i
d:CCD65769.1
DictyBaseDDB_G02737430.000000030002053728821195rps30-2 on chromosome: 2 posit
ion 3349136 to 3349937

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00526450(coding)
ATGGGTCGTATGCACGGTACTCTCGCTAAGGCCGGTAAGGTCAGAAAATAAACCCCCAAG
GTTGAAAAGAAGGACAAGCCCAGAAAGACTCCTAAGGGTAGATCTTACAAGAGAATCCTC
TACAACAGAAGATATGCTCCTCACATCTTGGCCACTGATCCCAAGAAGAGAAAGTCTCCC
AACTGGCACGCTGGTAAGAAGGAAAAGATGGACGCTGCTGCCAATCCCGTCAAGAAGGAT
TGA


>TTHERM_00526450(protein)
MGRMHGTLAKAGKVRKQTPKVEKKDKPRKTPKGRSYKRILYNRRYAPHILATDPKKRKSP
NWHAGKKEKMDAAANPVKKD


>TTHERM_00526450(gene)
ATGGGTAAGCCTTTTTTTTATTGAATATGCTGAACTTTCAAAATGCAAAATTTTTTCAAA
TGAACACCACTAAATTATTTTATCTTATTATAAAAACAGGTCGTATGCACGGTACTCTCG
CTAAGGCCGGTAAGGTAGGATATTCGCTTTATTCATTTTAAGCATCATCATGATGATATA
TTTTAATGATTTTTCTCTCCTTTCTTTAACGATTTGTATTAAGTTGAATTGGCAAATAGA
TAAATAAATATATTATTACCTTAAAAAGTAGAACAACATCTAATAGATTTTAAAATAAAT
TAAGGGAAAAAATGATATTTGATTCTTTGAAAATTATTTTAAGAATTCATTACACATTTA
GGCAAACAATACAAACAAATTTAGGGATATAAATATATAGATATGACAAATATTTTAATG
TATAAATTTCAAAGCTTTAAACAGCAAAAATTAATTGCTAATTTACTAAAAAAAGCTAAA
AGCGCTACTTAATTTGTTAAGAAATGAGAGAATTTCGTTAAAATATATTTTATTTTGCAA
ATTTCAAGCTATCAGAATCTAAATTTACTTATTTCTATTGAAAAAAATAGGTCAGAAAAT
AAACCCCCAAGGTTGAAAAGAAGGACAAGCCCAGAAAGACTCCTAAGGGTAGATCTTACA
AGAGAATCCTCTACAACAGAAGATATGCTCCTCACATCTTGGCCACTGATCCCAAGAAGA
GAAAGTCTCCCAACTGGCACGCTGGTAAGAAGGAAAAGATGGACGCTGCTGCCAATCCCG
TCAAGAAGGATTGA