Identifiers and Description

Gene Model Identifier

TTHERM_01151500

Standard Name

RPS3 (Ribosomal Protein of the Small subunit 3)

Aliases

PreTt20190 | 256.m00023 | 3826.m00073

Description

Homolog of yeast RPS3, human RPS3, bacterial RPS3;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01151500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20747.16.002770351825016e-173KH domain-containing protein (
244 aa)
SGDYNL178W9.99711830094262e-74RPS3 Protein component of the
small (40S) ribosomal subunit,
has apurinic/apyrimidinic (AP
) endonuclease activity; essen
tial for viability; has simila
rity to E. coli S3 and rat S3
ribosomal proteins
DictyBaseDDB_G02930002.0004485223439647e-69rps3 on chromosome: 6 position
2556040 to 2556944
OxytrichaContig3798.0.g422.0004485223439647e-69Ribosomal protein S3, C-termin
al domain
WormBaseWBGene000044725.997672135862771e-69locus:rps-3 40S ribosomal pr
otein S3 status:Confirmed
UniProt:P48152 protein_id:CC
D65297.1
Stentor CoeruleusSteCoe_20081.603810890548638e-28

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_01151500(coding)
ATGGACAAGACCACTAGAGCTATCAACAAGAAGAAGAAATTCGTTGCCGATGGTGTTTTC
AACGCTGAATTACACTCTTTCTTCTCCAAGTCTCTCCAAGATGCTGGTTATGCTGGTATT
GAAGTCAGAAGAACTCCCACCAAGACCGAAATCAGAATTAAGGCCACCAAGCCCTAATAA
GTTATCGGTGTTGAAGGTAAGAAGCACAAGGAACTTACCCAATTCCTCCAAAAGAGATTC
GGTTACTCTGATGACTAAATCCAAATCTGGGCTGAACCCATCAAGTTCAAGGGTTTATGC
GCCTCTGCTTAAGTCGAAGCCATGAACTACAAGTTATTGAAGGACGTCCCCGTCAGATTG
GCTGCTAACTACATCATCAAGTCCGTCATCCAAGATGGTGCTAAGGGTTGTGAAATCATT
ATCTCTGGTAAATTAAAATAACAAAGAGCTAAGACCATGAAGTTCAAGCAAGGTTATATG
ATCTGTACCGGTCAACCCAAGAACGACTACATCGATGTTGCCGTCAGACACGTCTTCTTC
AAGCAAGGTATTATGGGTGTTAAGGTAAAGATTATGTTACCCTACGAACCTAACCCAGCT
AAGAAGTTCGGTGTTAAGACTCCTATCCCCGATAACGTTATTATCCACCCCCCCAAATAA
ATTACCGACGATAAGGAAATCAGAACCGCTGTTGAATAATAACAACCTGCTCAACCTGAA
CAACAATAATGA


>TTHERM_01151500(protein)
MDKTTRAINKKKKFVADGVFNAELHSFFSKSLQDAGYAGIEVRRTPTKTEIRIKATKPQQ
VIGVEGKKHKELTQFLQKRFGYSDDQIQIWAEPIKFKGLCASAQVEAMNYKLLKDVPVRL
AANYIIKSVIQDGAKGCEIIISGKLKQQRAKTMKFKQGYMICTGQPKNDYIDVAVRHVFF
KQGIMGVKVKIMLPYEPNPAKKFGVKTPIPDNVIIHPPKQITDDKEIRTAVEQQQPAQPE
QQQ


>TTHERM_01151500(gene)
ATGGACAAGACCACTAGAGCTATCAACAAGAAGAAGAAAGTAATTAAACTGAATTCCATT
TTTTTAAATTACAAGTGCTTAGCGTACAGAAAATAATTTCAGAATCGCTAATGCCCTTCT
TCAACTTTTGAATTCAATTTTTGCATTTTGTTAAACTTATCATTTTAATCAATAGTTCGT
TGCCGATGGTGTTTTCAACGCTGAATTACACTCTTTCTTCTCCAAGTCTCTCCAAGATGC
TGTAAGAATTTATTTACATTACTAAATTAGCAAAATACTACAGGAATAAATCAGATATTA
GAATTAAGAAGAGCTTTCTTTCCTCATTATTAGTATAATTTAGCAAAACAAAACTGAAAA
TGATAGATTAAAACTGAATGTAGCAATTCTATTTACAATCTGAGTTTAAGATAATTTTAT
CCTTGGCACAAAATTCAATAATTTGTTTAAATGATAGCTTAAAGCCAGCATAAAGCTTTA
CAAATTTGCTGAATAACATGTTTTAATTCAATCGGGAAAAATTTTTGAAGAGTAACAACT
ATAATCAAACTAAATGTTAATAAAACTAAGCTAATGAAAACATTGTTCGTTCATTTGAAT
GAATGAATCATTCATTAAGCGAAAGATCTTATCTATAACAGCTTGATAAATTTTGATATA
CAAAAATGAATAATTTTCATTTTATTTTTCAATCAGTATAAAATAAATAAATTTCTTTTA
CTTTTGCCGCAAGTAAATCGAAACATTTAGCCTAGGTAGTTTGAATAAATTTTGCTAAAA
AGAGCCAGGTTGAAATGAAAATATAGTTTTATAAACCTAAAATAATAATGCTAAGAAAAG
AGAGTTCTACTTGTTCTAATATTAATTGATATTTAAAATAACATTTGAAATGAAAATGTT
AAATTTTATTTGCTAATTAAAATGTTTTTTTATAAATCGTATTTATCTAAATAAATTATC
TAAATTATAGGGTTATGCTGGTATTGAAGTCAGAAGAACTCCCACCAAGACCGAAATCAG
AATTAAGGCCACCAAGCCCTAATAAGTTATCGGTGTTGAAGGTAAGAAGCACAAGGAACT
TACCCAATTCCTCCAAAAGAGATTCGGTTACTCTGATGACTAAATCCAAATCTGGGCTGA
ACCCATCAAGTTCAAGGGTTTATGCGCCTCTGCTTAAGTCGAAGCCATGAACTACAAGTT
ATTGAAGGACGTCCCCGTCAGATTGGCTGCTAACTACATCATCAAGTCCGTCATCCAAGA
TGGTGCTAAGGGTTGTGAAATCATTATCTCTGGTAAATTAAAATAACAAAGAGCTAAGAC
CATGAAGTTCAAGCAAGGTTATATGATCTGTACCGGTCAACCCAAGAACGACTACATCGA
TGTTGCCGTCAGACACGTCTTCTTCAAGCAAGTAATACCTTTCTTCATTTTAAATTATTA
ATTAATTCATTTACTAAAAGTCTCTAACTGTTTTTTTAAATAATTATTATAGGGTATTAT
GGGTGTTAAGGTAAAGATTATGTTACCCTACGAACCTAACCCAGCTAAGAAGTTCGGTGT
TAAGACTCCTATCCCCGATAACGTTATTATCCACCCCCCCAAATAAATTACCGACGATAA
GGAAATCAGAACCGCTGTTGAATAATAACAACCTGCTCAACCTGAACAACAATAATGA