Identifiers and Description

Gene Model Identifier

TTHERM_00037090

Standard Name

RPS29 (Ribosomal Protein of the Small subunit 29)

Aliases

PreTt14444 | 2.m02275 | 3825.m02816

Description

Homolog of yeast RPS29, human RPS29, bacterial RPS14

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00037090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig22313.0.g61.000116773704384e-19Ribosomal protein S14p/S29e
DictyBaseDDB_G02723081.999598840915195e-17rps29 on chromosome: 2 positio
n 1258878 to 1259135
SGDYDL061C3.001003044337619e-17RPS29B Protein component of th
e small (40S) ribosomal subuni
t; nearly identical to Rps29Ap
and has similarity to rat S29
and E. coli S14 ribosomal pro
teins
WormBaseWBGene000044980.0000000000000030004923591262316locus:rps-29 status:Confirme
d UniProt:P90983 protein_i
d:CCD61868.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00037090(coding)
ATGCCTAACAAATTGTGGAGAACTCACCCCAGAAACTACGGTAAAGACTCTAAGGAATGC
AGAGTTTGTGGTGCCAGATAAGGTCTTATCACCAAGTATGAAATGATGACTTGCAGAAGA
TGCTTCAGAGAATAAGCTCCTCACATTGGTTTCGTCAAGTACAGATGA


>TTHERM_00037090(protein)
MPNKLWRTHPRNYGKDSKECRVCGARQGLITKYEMMTCRRCFREQAPHIGFVKYR


>TTHERM_00037090(gene)
AAGAAAAAAACTAAGAAAAAAGACAATAATCACATATTTTAACACCAATTCAAAATGCCT
AACAAATTGTGGAGAACTCACCCCAGAAACTACGGTAAAGACTCTAAGGAATGCAGAGTT
TGTGGTGCCAGATAAGGTCTTATCACCAAGTATGAAATGATGACTTGCAGAAGATGCTTC
AGAGAATAAGCTCCTCACATTGGTTTCGTCAAGGTAACATATAGCAATAGCAATTTAATC
AATCATATTTAATTTTAATCGATCAATAAATTATCATTCAATGAGTGTCAATTACCAAAA
CGTTTTACTAAATTAATTACCATCAAGTATTAATAGATAAAGTTAATAATAGAATTTAAG
TAGTGCCATAGTTTGTCTAATTATTAGAATTATCGGCCTTATTAAAGCTGTAAACATTTT
AAAATCGTCCAACAAATAAATAAAAAACAATTGATTAATGAATCGATCAGCCAAAAAGTT
AATTCCAAATAAATTAACTTTAAGAAAATCTACTTTAATTAAGCTAAATTGTTAGCTTGA
TTGAGTATAAATAAACAATTATGAAAGGATTAAAAAACCGAATGACAATCCATAGATTAA
ATCAAGGTTTGAGTTAAAGAAAGAGCCTTTACTAGCTTCTTAAACTGAAGTACTTAGCTT
TTAGAATGAGTGTAGTACTGACTTAAGTAAAAAAGAAATGAAATAAAGTTTCATGCATGC
ATGTATTCTTTTAAAGAAAAATAATAATTTGATTTATTTATTACAGAAAAAATCAAGGAA
CAGAGTTAAGCAAGCAAAAAAGGACTAAGTAGAGGATAAAAATAATAAGATAAAATAGCA
AATTATATAGAATCAATAATAATAACTAAAAGGAAGTAGAATGCACAAAATAAATCATTA
GAATTAGCTATTTATTTGAAAGAAGTAGAATAAAAAAATAAGTAAATCCATACCGCATAT
ATTATTCTCTGCATAGAGTAATTAACTTATGTATGGACAAATAAATTACCATTTCAATAA
TCCCTATAATATTTTTATATAATTTAGGATTCGCTAAATGGAAACAAAAAAATAATAATA
ATAACCAATCAATTAATATCAAAAGCATTCAAATTTTTAGTTAATTCAATTCAATGATTA
ATTCCTCCATTTACTTCTAATTAATTGATTATCCTAAATCCTAACTTAATCTGTTCAAAA
GCATTAATTAAAATGAGTTTGTTGGACTTTTAAAAAGTGATGAATGATATGATGTTTATT
TTTTGGCATGAAAAATAAAATAATTAGTTTACAATTTGGTGAGAAAGCACTCATTAATTC
ATTTAGAATGATAATTTTGATTTTATTTTTGAATATTAGTTTATTTTTAATTTAATGATA
ATTATTATAACAAACAGTACAGATGAAGAACCTTATGTAAACGGAGATTAGCAAAAATTT
AAAATATACTCAAAATATATCTATTGTATGTGAATAATAGAAATATAGATTTAAATTTAA
CTAATTGCTTCTTTATGTAAGCTAACTTGCATAATATATTATTACATATAGATAACTTTT
TATTTAAATCTGTTCTAACTTAATTCATCAAAATCATTTCAAAAAAACAGCCTTTCTCTT
TGTTTTATTCACCACTCTTTTCAATCTTAATCTTGGAGTATATATAAATTAATTTATGTT
TCTTAAATTAATTAATTAATTAATTTTCGACCAAAACAAAACACAAATATTTTTATCACT
CCTAAATATTAAAATGCAACAAAATTCAGCTAAACTAAATAAAACAAAGCAAAATATTAT
TCATTAATATTTCTAACAATTTTAGACAATTTGCACTAGAAAGTAAAAATAAAGAAATAA
ATAAATAAATAAAAACTTTCTATCTATTTTTCTATCTATCTATAAAGGTATCCTTAAACA
ACTTAAC