Identifiers and Description

Gene Model Identifier

TTHERM_00037090

Standard Name

RPS29 (Ribosomal Protein of the Small subunit 29)

Aliases

PreTt14444 | 2.m02275 | 3825.m02816

Description

RPS29 40S ribosomal protein S29; Homolog of yeast RPS29- human RPS29- bacterial RPS14

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00037090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig22313.0.g61.000116773704384e-19Ribosomal protein S14p/S29e
DictyBaseDDB_G02723081.999598840915195e-17rps29 on chromosome: 2 positio
n 1258878 to 1259135
SGDYDL061C3.001003044337619e-17RPS29B Protein component of th
e small (40S) ribosomal subuni
t; nearly identical to Rps29Ap
and has similarity to rat S29
and E. coli S14 ribosomal pro
teins
WormBaseWBGene000044980.0000000000000030004923591262316locus:rps-29 status:Confirme
d UniProt:P90983 protein_i
d:CCD61868.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21205638: Rabl J, Leibundgut M, Ataide SF, Haag A, Ban N (2011) Crystal structure of the eukaryotic 40S ribosomal subunit in complex with initiation factor 1. Science (New York, N.Y.) 331(6018):730-6

Sequences

>TTHERM_00037090(coding)
ATGGAATGGCAGACTGCTTTTGTTTAAATAAATGATAAAAAGTAAATGAAAAAGTAAAAA
AAAGCAATAGGTTAAAACGAGATTAAAGGATAACAAAGAAGGGAAAAAGGCAAATTTAAC
AGGAAAAAAGACAATAATCACATATTTTAACACCAATTCAAAATGCCTAACAAATTGTGG
AGAACTCACCCCAGAAACTACGGTAAAGACTCTAAGGAATGCAGAGTTTGTGGTGCCAGA
TAAGGTCTTATCACCAAGTATGAAATGATGACTTGCAGAAGATGCTTCAGAGAATAAGCT
CCTCACATTGGTTTCGTCAAGATTTTAATAAAAGCTAACTTATAATAATTTAAATGA


>TTHERM_00037090(protein)
MEWQTAFVQINDKKQMKKQKKAIGQNEIKGQQRREKGKFNRKKDNNHIFQHQFKMPNKLW
RTHPRNYGKDSKECRVCGARQGLITKYEMMTCRRCFREQAPHIGFVKILIKANLQQFK


>TTHERM_00037090(gene)
ATGGAATGGCAGACTGCTTTTGTTTAAATAAATGATAAAAAGTAAATGAAAAAGTAAAAA
AAAGCAATAGGTTAAAACGAGATTAAAGGATAACAAAGAAGGGAAAAAGGCAAATTTAAC
AGGGTAAAAGATACAACTAAATTTTTACTTGAGAAAAGAGCTGCTTGAAATAATTAAGAA
TTTATTAAGAAAAAAACTAAGAAAAAAGACAATAATCACATATTTTAACACCAATTCAAA
ATGCCTAACAAATTGTGGAGAACTCACCCCAGAAACTACGGTAAAGACTCTAAGGAATGC
AGAGTTTGTGGTGCCAGATAAGGTCTTATCACCAAGTATGAAATGATGACTTGCAGAAGA
TGCTTCAGAGAATAAGCTCCTCACATTGGTTTCGTCAAGGTAACATATAGCAATAGCAAT
TTAATCAATCATATTTAATTTTAATCGATCAATAAATTATCATTCAATGAGTGTCAATTA
CCAAAACGTTTTACTAAATTAATTACCATCAAGTATTAATAGATAAAGTTAATAATAGAA
TTTAAGTAGTGCCATAGTTTGTCTAATTATTAGAATTATCGGCCTTATTAAAGCTGTAAA
CATTTTAAAATCGTCCAACAAATAAATAAAAAACAATTGATTAATGAATCGATCAGCCAA
AAAGTTAATTCCAAATAAATTAACTTTAAGAAAATCTACTTTAATTAAGCTAAATTGTTA
GCTTGATTGAGTATAAATAAACAATTATGAAAGGATTAAAAAACCGAATGACAATCCATA
GATTAAATCAAGGTTTGAGTTAAAGAAAGAGCCTTTACTAGCTTCTTAAACTGAAGTACT
TAGCTTTTAGAATGAGTGTAGTACTGACTTAAGTAAAAAAGAAATGAAATAAAGTTTCAT
GCATGCATGTATTCTTTTAAAGAAAAATAATAATTTGATTTATTTATTACAGAAAAAATC
AAGGAACAGAGTTAAGCAAGCAAAAAAGGACTAAGTAGAGGATAAAAATAATAAGATAAA
ATAGCAAATTATATAGAATCAATAATAATAACTAAAAGGAAGTAGAATGCACAAAATAAA
TCATTAGAATTAGCTATTTATTTGAAAGAAGTAGAATAAAAAAATAAGTAAATCCATACC
GCATATATTATTCTCTGCATAGAGTAATTAACTTATGTATGGACAAATAAATTACCATTT
CAATAATCCCTATAATATTTTTATATAATTTAGGATTCGCTAAATGGAAACAAAAAAATA
ATAATAATAACCAATCAATTAATATCAAAAGCATTCAAATTTTTAGTTAATTCAATTCAA
TGATTAATTCCTCCATTTACTTCTAATTAATTGATTATCCTAAATCCTAACTTAATCTGT
TCAAAAGCATTAATTAAAATGAGTTTGTTGGACTTTTAAAAAGTGATGAATGATATGATG
TTTATTTTTTGGCATGAAAAATAAAATAATTAGTTTACAATTTGGTGAGAAAGCACTCAT
TAATTCATTTAGAATGATAATTTTGATTTTATTTTTGAATATTAGTTTATTTTTAATTTA
ATGATAATTATTATAACAAACAGTACAGATGAAGAACCTTATGTAAACGGAGATTAGCAA
AAATTTAAAATATACTCAAAATATATCTATTGTATGTGAATAATAGAAATATAGATTTAA
ATTTAACTAATTGCTTCTTTATGTAAGCTAACTTGCATAATATATTATTACATATAGATA
ACTTTTTATTTAAATCTGTTCTAACTTAATTCATCAAAATCATTTCAAAAAAACAGCCTT
TCTCTTTGTTTTATTCACCACTCTTTTCAATCTTAATCTTGGAGTATATATAAATTAATT
TATGTTTCTTAAATTAATTAATTAATTAATTTTCGACCAAAACAAAACACAAATATTTTT
ATCACTCCTAAATATTAAAATGCAACAAAATTCAGCTAAACTAAATAAAACAAAGCAAAA
TATTATTCATTAATATTTCTAACAATTTTAGACAATTTGCACTAGAAAGTAAAAATAAAG
AAATAAATAAATAAATAAAAACTTTCTATCTATTTTTCTATCTATCTATAAAGGTATCCT
TAAACAACTTAACAAAATATTTTATTTTTCATTAATAAAACCAAATTATTTTGCCAATTA
TTACAAAAAATAAATATTAAAATATTTTATTTTATATAATTTAATTAAAAATAAATTTAA
TAATCTCAATGCACTATTATATTAATATTAATATAATAAAAATTTAATCTGATTATGAAT
TGAAAGCTATTTAAAAACTCGTATTTATTTTTCATTTATAAATCCTGAAAATTTAAATAA
TAATTTTAATTAAAACCATTTTAAACACAAAATAAAATTATATTTTTAGTTCTTTAATAC
ATATTATTACATAAGAAACTTATAAATAATCATTCATAATGTTTCTATAAATTTTTATTC
ATAAGATTTTAATAAAAGCTAACTTATAATAATTTAAATGA